DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat1 and LPCAT4

DIOPT Version :9

Sequence 1:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_705841.2 Gene:LPCAT4 / 254531 HGNCID:30059 Length:524 Species:Homo sapiens


Alignment Length:226 Identity:54/226 - (23%)
Similarity:84/226 - (37%) Gaps:56/226 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PFLYETNHIFRYY-FKFLMYYGIVSFNSIILIPAFLTRPCDVRNLLWASTW-------------- 69
            ||::|. |:.|.. .||.:...:::...::|  ||:     |..|||...|              
Human    24 PFVHEL-HLSRLQRVKFCLLGALLAPIRVLL--AFI-----VLFLLWPFAWLQVAGLSEEQLQEP 80

  Fly    70 --------CHR--------VSTLIG-LRWELRGKEHLAKDQACIIVANHQSSLDVLGMFNIWHVM 117
                    ||.        :..|:| ||..:||:.........::.|.|.:..|.:       |:
Human    81 ITGWRKTVCHNGVLGLSRLLFFLLGFLRIRVRGQRASRLQAPVLVAAPHSTFFDPI-------VL 138

  Fly   118 NKC---TVVAKRELFYAWPFGLAAWLAGLIFIDRVRGEKARETLNDVNRRIKK--QRIKLWVFPE 177
            ..|   .||::.|.......|........|.:.|......|..:.:|.||...  :..::..|||
Human   139 LPCDLPKVVSRAENLSVPVIGALLRFNQAILVSRHDPASRRRVVEEVRRRATSGGKWPQVLFFPE 203

  Fly   178 GTRRNTGALHPFKKGAFHMAIDQQIPILPVV 208
            ||..|..||..||.|||...    :|:.||:
Human   204 GTCSNKKALLKFKPGAFIAG----VPVQPVL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 39/153 (25%)
LPCAT4NP_705841.2 LPLAT_LPCAT1-like 109..306 CDD:153253 33/133 (25%)
HXXXXD motif 129..134 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 489..524
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.