DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat1 and LCLAT1

DIOPT Version :9

Sequence 1:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_872357.2 Gene:LCLAT1 / 253558 HGNCID:26756 Length:414 Species:Homo sapiens


Alignment Length:291 Identity:65/291 - (22%)
Similarity:112/291 - (38%) Gaps:86/291 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YFKFLMYYGIVSFNSIILIPAFLTRPCDVRNLLW--------ASTW----CHRVSTLIGLRWELR 84
            ||...:::|.. |.||.::..||  |....|..|        .:||    ...:.|:.|::..:.
Human    46 YFILTLFWGSF-FGSIFMLSPFL--PLMFVNPSWYRWINNRLVATWLTLPVALLETMFGVKVIIT 107

  Fly    85 GKEHLAKDQACIIVANHQSSLDVLGMFNIWHVMNKCT------VVAKRELFYAWPFGLAAWLAGL 143
            |...:..::: :|:.||::.:|  .|| :|:.:.:.:      :..|..|.....||.|...|..
Human   108 GDAFVPGERS-VIIMNHRTRMD--WMF-LWNCLMRYSYLRLEKICLKASLKGVPGFGWAMQAAAY 168

  Fly   144 IFI------DRVRGEKARETLNDVNRRIKKQRIKLWVFPEGT--------RRNTGA--------- 185
            |||      |:...|...:...|::     :.::|.:|||||        |.|..|         
Human   169 IFIHRKWKDDKSHFEDMIDYFCDIH-----EPLQLLIFPEGTDLTENSKSRSNAFAEKNGLQKYE 228

  Fly   186 --LHPFKKGAFHMAID-----QQIPILPVVFSSYCTFLNDKKKILNSG-----------RIVITT 232
              |||...| |...:|     :.:..:..:..:|...:...:|.|..|           |..|.|
Human   229 YVLHPRTTG-FTFVVDRLREGKNLDAVHDITVAYPHNIPQSEKHLLQGDFPREIHFHVHRYPIDT 292

  Fly   233 LPPVSTEGLTKDDIDVLM--------ERVRS 255
            ||      .:|:|:.:..        ||:||
Human   293 LP------TSKEDLQLWCHKRWEEKEERLRS 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 50/238 (21%)
LCLAT1NP_872357.2 PRK14014 45..324 CDD:237584 65/291 (22%)
LPLAT_LCLAT1-like 93..286 CDD:153252 41/202 (20%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q9D517 123..128 1/4 (25%)
Acyltransf_C 272..344 CDD:292694 13/52 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.