DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat1 and Lclat1

DIOPT Version :9

Sequence 1:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_036016461.1 Gene:Lclat1 / 225010 MGIID:2684937 Length:492 Species:Mus musculus


Alignment Length:208 Identity:53/208 - (25%)
Similarity:88/208 - (42%) Gaps:48/208 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YFKFLMYYGIVSFNSIILIPAFLTRPCDVRNLLW--------ASTW----CHRVSTLIGLRWELR 84
            ||...::.|.. |.||.::...|  |....||.|        .:||    ...:.|:.|:|..:.
Mouse   124 YFILFLFAGSF-FGSIFMLGPIL--PLMFINLSWYRWISSRLVATWLTLPVALLETMFGVRVVIT 185

  Fly    85 GKEHLAKDQACIIVANHQSSLDVLGMFNIWHVMNKCT------VVAKRELFYAWPFGLAAWLAGL 143
            |...:..::: :|:.||::.:|  .|| :|:.:.:.:      :..|..|.....||.|..:|..
Mouse   186 GDAFVPGERS-VIIMNHRTRVD--WMF-LWNCLMRYSYLRVEKICLKSSLKSVPGFGWAMQVAAF 246

  Fly   144 IFIDRV-RGEKAR-ETLNDVNRRIKKQRIKLWVFPEGT--------RRNTGA-----------LH 187
            |||.|. :.:|:. |.:.|....| .:.::|.:|||||        |.|..|           ||
Mouse   247 IFIHRKWKDDKSHFEDMIDYFCAI-HEPLQLLIFPEGTDLTENNKARSNDFAEKNGLQKYEYVLH 310

  Fly   188 PFKKGAFHMAIDQ 200
            |...| |...:|:
Mouse   311 PRTTG-FTFVVDR 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 40/158 (25%)
Lclat1XP_036016461.1 LPLAT_LCLAT1-like 171..364 CDD:153252 40/158 (25%)
Acyltransf_C 349..422 CDD:406475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.