DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat1 and bus-18

DIOPT Version :9

Sequence 1:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_505971.2 Gene:bus-18 / 186277 WormBaseID:WBGene00044631 Length:391 Species:Caenorhabditis elegans


Alignment Length:298 Identity:63/298 - (21%)
Similarity:111/298 - (37%) Gaps:96/298 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YYFKFLMYYGIVSFNSIILIPAFLTRPCDVRNLLWASTWCHRVS-----------TLIGLRWELR 84
            ::|...:.:..:..|.||.:  ||..|...|:..|.:.....:|           .|:|:|..:.
 Worm    13 WFFGLCILFSALFGNYIITL--FLGLPILGRHKQWRNLMDRAISYWMTIPMGLLEFLMGVRIRVS 75

  Fly    85 GKEHLAKDQACIIVANHQSSLDVLGMF------NIWHV-MNKCTVVAKRELFYAWPFGLAAWLAG 142
            |.| :......:||.||::.||.:.|:      |.|.: .||.::.|:.:......||:||  |.
 Worm    76 GDE-IEFGSPAMIVMNHRTRLDWMYMWCALYQINPWLITSNKISLKAQLKKLPGAGFGMAA--AQ 137

  Fly   143 LIFIDRVRGEKARETLNDVNRRIKK--QRIKLWVFPEGT-------------------------- 179
            .:|::| ..|..:.:.:|.....|.  ::.::.:|||||                          
 Worm   138 FVFLER-NAEVDKRSFDDAIDYFKNIDKKYQILLFPEGTDKSEWTTLKSREFAKKNGLRHLDYVL 201

  Fly   180 -RRNTGALHPFKKGAFHMAIDQQIPILPVVFSSYCTFLNDKKKILNSGRIVITTLPPVSTEGLTK 243
             .|.||.||...|      :.:|         .|..::.|           ||...|.:   :.:
 Worm   202 YPRTTGFLHLLNK------MREQ---------EYVEYIYD-----------ITIAYPYN---IVQ 237

  Fly   244 DDIDVLMERVRSQMIETFKVTSAEALH---RYKPIKKV 278
            .:||:::           |..|...:|   |..||.:|
 Worm   238 SEIDLVL-----------KGASPREVHFHIRKIPISQV 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 47/230 (20%)
bus-18NP_505971.2 LPLAT_LCLAT1-like 63..257 CDD:153252 49/237 (21%)
Acyltransf_C 249..329 CDD:374349 5/16 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.