DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat1 and acl-13

DIOPT Version :9

Sequence 1:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_502370.1 Gene:acl-13 / 184203 WormBaseID:WBGene00008581 Length:363 Species:Caenorhabditis elegans


Alignment Length:128 Identity:32/128 - (25%)
Similarity:53/128 - (41%) Gaps:27/128 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 CHRVSTLIGLRWELRGK--EHLAKDQACIIVANHQSSLDVLGMFNIWHVMNKCTVVAKRE----- 127
            |.|::   |::..:.|.  |.|. |...:::.||      ||:|:.:..|..........     
 Worm    75 CVRIT---GIKVMMSGDGLERLT-DCRALLLPNH------LGLFDHFIFMTAADSFGVNAVGRWI 129

  Fly   128 --LFYAWPFGLAAWL---AGLIFIDRVRGEKARETLNDVNR---RIKKQRIKLW--VFPEGTR 180
              ::..|.:....||   .|..|||.|...|..:||:.:.|   ||..:....|  ::|||:|
 Worm   130 FVIYNMWIYSPLGWLWSSYGNYFIDSVPPHKRAQTLHSLRRHFDRIYHEVDLRWLCLYPEGSR 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 32/128 (25%)
acl-13NP_502370.1 LPLAT 78..286 CDD:388412 30/125 (24%)
Acyltransf_C 279..>328 CDD:374349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.