DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat1 and Agpat4

DIOPT Version :9

Sequence 1:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_006227918.1 Gene:Agpat4 / 170919 RGDID:619916 Length:414 Species:Rattus norvegicus


Alignment Length:269 Identity:59/269 - (21%)
Similarity:104/269 - (38%) Gaps:82/269 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IELLGLFLLLMLPFLYETNHIFRYYFKFLMYYGIVSFNSIILIPAFLTRPCDVRNLLWA------ 66
            ::|:||.....|..|     :|.|.|   :..|:: .|:|.|        |.:  ::|.      
  Rat    37 MDLIGLLKSQFLCHL-----VFCYVF---IASGLI-VNAIQL--------CTL--VIWPINKQLF 82

  Fly    67 ----STWCHRVST--LIGLRW----------ELRGKEHLAKDQACIIVANHQSSLDVLGMFNIWH 115
                :..|:.||:  ::.|.|          :.:...|..|:.| |:|.||:..:|.|..:::..
  Rat    83 RKINARLCYCVSSQLVMLLEWWSGTECTIYTDPKASPHYGKENA-IVVLNHKFEIDFLCGWSLAE 146

  Fly   116 ---VMNKCTVVAKRELFYAWPFGLAAWLAGLIFIDRVRGEKARETLNDVNRRIKKQRIKLWVFP- 176
               ::....|:||:||.|....|...:...:||..| :.|:.|:|       :.|..:.|..:| 
  Rat   147 RLGILGNSKVLAKKELAYVPIIGWMWYFVEMIFCTR-KWEQDRQT-------VAKSLLHLRDYPE 203

  Fly   177 --------EGTR-------------RNTGA------LHPFKKGAFHMAIDQQIPILPVVFSSYCT 214
                    ||||             :..|.      |.|..|| |.:.:.....::|.|:.....
  Rat   204 KYLFLIHCEGTRFTEKKHQISMQVAQAKGLPSLKHHLLPRTKG-FAITVKCLRDVVPAVYDCTLN 267

  Fly   215 FLNDKKKIL 223
            |.|::...|
  Rat   268 FRNNENPTL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 45/197 (23%)
Agpat4XP_006227918.1 PlsC 51..325 CDD:223282 55/255 (22%)
LPLAT_LCLAT1-like 98..292 CDD:153252 42/189 (22%)
Acyltransf_C 279..350 CDD:292694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.