DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat1 and AGPAT2

DIOPT Version :9

Sequence 1:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_006403.2 Gene:AGPAT2 / 10555 HGNCID:325 Length:278 Species:Homo sapiens


Alignment Length:276 Identity:93/276 - (33%)
Similarity:146/276 - (52%) Gaps:21/276 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LLMLPFLYETNHIFRYYFKFLMYYGIVSFNSIILIPAFLTRPC-------DVRNLLWASTWCHRV 73
            ||:|..|.:.:....:|.|..:|..:     ...:.|..:..|       .|.|:.....:....
Human    11 LLLLLLLVQLSRAAEFYAKVALYCAL-----CFTVSAVASLVCLLRHGGRTVENMSIIGWFVRSF 70

  Fly    74 STLIGLRWELRGKEHLAKDQACIIVANHQSSLDVLGMFNIWHVMNKCTVVAKRELFYAWPFGLAA 138
            ....|||:|:|....|.:.:.|:||:||||.||::|:..:  :..:|..:|||||.:..|.||..
Human    71 KYFYGLRFEVRDPRRLQEARPCVIVSNHQSILDMMGLMEV--LPERCVQIAKRELLFLGPVGLIM 133

  Fly   139 WLAGLIFIDRVRGEKARETLNDVNRRIKKQRIKLWVFPEGTRRNTGALHPFKKGAFHMAIDQQIP 203
            :|.|:.||:|.|...|...:.|:..|:.::.:|:|::|||||.:.|.|.|||||||::|:..|:|
Human   134 YLGGVFFINRQRSSTAMTVMADLGERMVRENLKVWIYPEGTRNDNGDLLPFKKGAFYLAVQAQVP 198

  Fly   204 ILPVVFSSYCTFLNDKKKILNSGRIVITTLPPVSTEGLTKDDIDVLMERVRSQMIETFKVTSAEA 268
            |:|||:||:.:|.|.|||...||.:.:..|..:.|.|||..|:..|::.....|..||       
Human   199 IVPVVYSSFSSFYNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHRAMRTTF------- 256

  Fly   269 LHRYKPIKKVGIPAAS 284
            ||..|..::.|..|.|
Human   257 LHISKTPQENGATAGS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 73/183 (40%)
AGPAT2NP_006403.2 LPLAT_AGPAT-like 67..249 CDD:153251 73/183 (40%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q9D517 98..103 3/4 (75%)
EGTR motif. /evidence=ECO:0000305|PubMed:21873652 172..175 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141868
Domainoid 1 1.000 135 1.000 Domainoid score I4983
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 214 1.000 Inparanoid score I3631
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1623097at2759
OrthoFinder 1 1.000 - - FOG0001236
OrthoInspector 1 1.000 - - otm42238
orthoMCL 1 0.900 - - OOG6_100535
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2233
SonicParanoid 1 1.000 - - X864
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.690

Return to query results.
Submit another query.