DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat1 and Gpat4

DIOPT Version :9

Sequence 1:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_011240406.1 Gene:Gpat4 / 102247 MGIID:2142716 Length:462 Species:Mus musculus


Alignment Length:314 Identity:72/314 - (22%)
Similarity:118/314 - (37%) Gaps:91/314 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LYETNHIFRYY-FKFLMYYGI-VSFNSIILIPAFLTRPCDVRNLLWASTWCHRVSTLIGLRWELR 84
            |..||:.|:|. .:..:.:|: |......|:|..:........||...|      |::|.....|
Mouse   146 LSRTNYNFQYISLRLTILWGLGVLIRYCFLLPLRIALAFTGIGLLVVGT------TMVGYLPNGR 204

  Fly    85 GKEHLAKD------QAC---------------------IIVANHQSSLDVLGMFN------IWHV 116
            .||.|:|.      :.|                     |.||||.|.:||:.:.:      :..|
Mouse   205 FKEFLSKHVHLMCYRICVRALTAIITYHNRKNRPRNGGICVANHTSPIDVIILASDGYYAMVGQV 269

  Fly   117 MNKCTVVAKRELFYAWPFGLAAWLAGLIFIDR-VRGEKARETLNDVNRRIKKQRIKLWVFPEGTR 180
            ......|.:|.:..|.|.   .|.......|| :..::..|.:.|      |.::.:.:|||||.
Mouse   270 HGGLMGVIQRAMVKACPH---VWFERSEVKDRHLVAKRLTEHVQD------KSKLPILIFPEGTC 325

  Fly   181 RNTGALHPFKKGAFHM-AIDQQIPILPVVFSSY-----CTFLNDKK--------KILNSGRIVIT 231
            .|..::..||||:|.: |....:.|.|.:...|     ..|.|..|        :::.|..||.:
Mouse   326 INNTSVMMFKKGSFEIGATVYPVAIKPPLLVQYDPQFGDAFWNSSKYGMVTYLLRMMTSWAIVCS 390

  Fly   232 T--LPPVSTEGLTKDD-------------------IDVLME--RVRSQMIETFK 262
            .  |||::.|   ||:                   :|:|.:  ..|.::.:|||
Mouse   391 VWYLPPMTRE---KDEDAVQFANRVKSAIARQGGLVDLLWDGGLKREKVKDTFK 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 56/254 (22%)
Gpat4XP_011240406.1 LPLAT_LPCAT1-like 218..433 CDD:153253 49/226 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.