Sequence 1: | NP_004494.1 | Gene: | HOXC6 / 3223 | HGNCID: | 5128 | Length: | 235 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_536752.1 | Gene: | Ubx / 42034 | FlyBaseID: | FBgn0003944 | Length: | 389 | Species: | Drosophila melanogaster |
Alignment Length: | 264 | Identity: | 82/264 - (31%) |
---|---|---|---|
Similarity: | 115/264 - (43%) | Gaps: | 76/264 - (28%) |
- Green bases have known domain annotations that are detailed below.
Human 7 NPSLSCHLAGGQDVLPNVA---------LNSTAYDPVRH------------------------FS 38
Human 39 TYGAAVAQNRIYSTPFYSPQENVVFSSSRGPYDYGSNSFYQEKDMLSNCRQNTLGHNTQTSIAQ- 102
Human 103 -DFSSEQGRTAPQDQKASIQIYPWMQRMNSHSGVGYGADRRRGRQIYSRYQTLELEKEFHFNRYL 166
Human 167 TRRRRIEIANALCLTERQIKIWFQNRRMKWKKESNLTSTLSGGGGGATADSLGGKEEKREETEEE 231
Human 232 KQKE 235 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HOXC6 | NP_004494.1 | Antp-type hexapeptide | 122..127 | 1/4 (25%) | |
Homeobox | 145..198 | CDD:395001 | 45/52 (87%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 200..235 | 5/34 (15%) | |||
Ubx | NP_536752.1 | Homeobox | 299..352 | CDD:395001 | 45/52 (87%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45659 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.910 |