DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXC6 and Ubx

DIOPT Version :9

Sequence 1:NP_004494.1 Gene:HOXC6 / 3223 HGNCID:5128 Length:235 Species:Homo sapiens
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:264 Identity:82/264 - (31%)
Similarity:115/264 - (43%) Gaps:76/264 - (28%)


- Green bases have known domain annotations that are detailed below.


Human     7 NPSLSCHLAGGQDVLPNVA---------LNSTAYDPVRH------------------------FS 38
            ||      |||..|.|:..         |:::...||.|                        ..
  Fly   146 NP------AGGMPVRPSACTPDSRVGGYLDTSGGSPVSHRGGSAGGNVSVSGGNGNAGGVQSGVG 204

Human    39 TYGAAVAQNRIYSTPFYSPQENVVFSSSRGPYDYGSNSFYQEKDMLSNCRQNTLGHNTQTSIAQ- 102
            ..||..|.|...:....:.|.    :::...:...:::||....:...|.::......::.:.| 
  Fly   205 VAGAGTAWNANCTISGAAAQT----AAASSLHQASNHTFYPWMAIAGECPEDPTKSKIRSDLTQY 265

Human   103 -DFSSEQGRTAPQDQKASIQIYPWMQRMNSHSGVGYGADRRRGRQIYSRYQTLELEKEFHFNRYL 166
             ..|::.|:...:....|: :..|:         |....||||||.|:||||||||||||.|.||
  Fly   266 GGISTDMGKRYSESLAGSL-LPDWL---------GTNGLRRRGRQTYTRYQTLELEKEFHTNHYL 320

Human   167 TRRRRIEIANALCLTERQIKIWFQNRRMKWKKESNLTSTLSGGGGGATADSLGGKEEKREETEEE 231
            |||||||:|:|||||||||||||||||||.|||.                     :..:|..|:|
  Fly   321 TRRRRIEMAHALCLTERQIKIWFQNRRMKLKKEI---------------------QAIKELNEQE 364

Human   232 KQKE 235
            ||.:
  Fly   365 KQAQ 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXC6NP_004494.1 Antp-type hexapeptide 122..127 1/4 (25%)
Homeobox 145..198 CDD:395001 45/52 (87%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..235 5/34 (15%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.