DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HOXC6 and Antp

DIOPT Version :10

Sequence 1:NP_004494.1 Gene:HOXC6 / 3223 HGNCID:5128 Length:235 Species:Homo sapiens
Sequence 2:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster


Alignment Length:110 Identity:70/110 - (63%)
Similarity:78/110 - (70%) Gaps:13/110 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   109 GRTAPQDQKASIQ-------IYPWMQRMNSHSGVGYGADRRRGRQIYSRYQTLELEKEFHFNRYL 166
            |:..|..|..:.|       :||||:     |..|...:|:||||.|:|||||||||||||||||
  Fly   263 GQHTPPSQNPNSQSSGMPSPLYPWMR-----SQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYL 322

Human   167 TRRRRIEIANALCLTERQIKIWFQNRRMKWKKESNLTSTLSGGGG 211
            |||||||||:||||||||||||||||||||||| |.|....|.||
  Fly   323 TRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE-NKTKGEPGSGG 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HOXC6NP_004494.1 Antp-type hexapeptide 122..127 3/4 (75%)
Homeodomain 142..198 CDD:459649 51/55 (93%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..235 5/12 (42%)
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 16/47 (34%)
Homeodomain 298..354 CDD:459649 51/55 (93%)

Return to query results.
Submit another query.