DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12717 and senp2

DIOPT Version :9

Sequence 1:NP_001285167.1 Gene:CG12717 / 32229 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_684283.2 Gene:senp2 / 556400 ZFINID:ZDB-GENE-060810-183 Length:598 Species:Danio rerio


Alignment Length:375 Identity:88/375 - (23%)
Similarity:149/375 - (39%) Gaps:90/375 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 GNKQGSHNSTAITSNSTMTSNGLRGVQPAEDAPAISQWIQSRNNAAVSKKSEETAGGSQSRVQSN 294
            |:|...|.|...|::       |....|....|.||.|   |:..::::..:.|..|.:|...|:
Zfish   259 GHKVSGHTSICRTTD-------LNRPAPVRVIPNISMW---RDPLSLTQIKDRTVDGHRSTTGSD 313

  Fly   295 V--ASISSPAVKATSDAAIPTPAERAERSRLRRNRNWILSRDVDEDAVV--LVSSGDEE-TTAAD 354
            |  .::.:...:.|: ..:...||...|..|:           |:|:.|  |:.|..|. |.|..
Zfish   314 VKEGALDNQTTRKTA-VDVDLSAEVEARLNLK-----------DKDSAVGLLIPSRSEVITDAVR 366

  Fly   355 DGQTE-----RRLSPDENQTLFTYPPT----GTGGLSITIKDFMCLSKGSYLNDIIIDFYLRWLK 410
            .|:.|     :.:..:.:..|....|.    ....|.||.:|...|.:||:|||.:|:||:..:.
Zfish   367 RGEEEFPRLTKEMQQEVSAALAQSDPNLVLCSAFKLRITQRDLATLQEGSWLNDEVINFYMNLVM 431

  Fly   411 NNIIPEEQRDRTHIFSTFFHKRLTTRTNPRNTKQTAAQKRHERVEKWTRNVNIFDKDFIIIPFNE 475
            .....|....:.:.||||...:|.:             ..|..|.:||:.|::|..|.|::|.:.
Zfish   432 ARSEQEVLGKKVYSFSTFLFPKLLS-------------GGHAAVRRWTKAVDLFLFDVILVPLHL 483

  Fly   476 QSHWILAIICYPNLRSPVVNNNNVQTTLSDDIPIKQPLILIFDSLAVTSRHRAIA-ILRDYLTCE 539
            ..||.||::.:                       |...:..:||:.  .||..|. ::..||..|
Zfish   484 GVHWSLAVVDF-----------------------KSKSVRSYDSMG--QRHDDICDLILLYLKEE 523

  Fly   540 HKAKYPNALAHVFNKDNMPGHSV-------EVPQQQNLTDCGLYLLQYVE 582
            .|.|.        .||......:       |:|||:|.:|||:::.:|.:
Zfish   524 FKVKK--------GKDLDVSKWIVSSLRPSEIPQQKNGSDCGVFICKYAD 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 20/90 (22%)
Peptidase_C48 396..585 CDD:304959 47/195 (24%)
senp2XP_684283.2 Peptidase_C48 <370..595 CDD:304959 57/242 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5303
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.