DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12717 and CG32110

DIOPT Version :9

Sequence 1:NP_001285167.1 Gene:CG12717 / 32229 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_729837.1 Gene:CG32110 / 317858 FlyBaseID:FBgn0052110 Length:411 Species:Drosophila melanogaster


Alignment Length:337 Identity:83/337 - (24%)
Similarity:119/337 - (35%) Gaps:108/337 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 AIPTPAERAERSRLRRN-----------RNWI-----LSRDVDEDAVVLVSSGDEETTAA----- 353
            |||...:.:...|.||:           |.|.     |:|....:|..|......|..|.     
  Fly   101 AIPAVFKHSHNRRFRRSLFLRSNYIEQFRRWTDQKNKLNRKRLNEAHQLCLKAKHERIACEIDRY 165

  Fly   354 ------------DDGQTERRLSP------DENQTLFTYP----PTGTGGLSITIKDFMCLSKGSY 396
                        :|.:....|.|      |....|..||    ......|.|...|...|:.|.:
  Fly   166 KKLILKQSVHVIEDIRISSELIPLTKEHHDRLMELSKYPLQQVIVAKFNLDICGSDIKILTSGGW 230

  Fly   397 LNDIIIDFYLRWLKNNIIPEEQRDR------THIFSTFFHKRLTTRTNPRNTKQTAAQKRHERVE 455
            |||.||:||:     |::.|....|      .:..||||..||             .|...:.|:
  Fly   231 LNDKIINFYM-----NLLVERSEKRPGTVPSVYAMSTFFVPRL-------------LQSGFDGVK 277

  Fly   456 KWTRNVNIFDKDFIIIPFNEQ-SHWILAIICYPNLRSPVVNNNNVQTTLSDDIPIKQPLILIFDS 519
            :|||.|::|..|.|::|.::. .||.|.||                     |:|.|       ..
  Fly   278 RWTRKVDLFSMDLILVPVHQMLVHWCLVII---------------------DLPAK-------TM 314

  Fly   520 LAVTSRHRA----IAILRDYLTCEHKAKYPNAL-AHVFNKDNMPGHSVEVPQQQNLTDCGLYLLQ 579
            |...||.|.    :..|..||..|.:.|....| ...|..::    :..||||.|:.|||:::..
  Fly   315 LYYNSRGRGDPNLMRALVKYLQMESEDKLGLCLDTSEFRIED----AQNVPQQDNMNDCGVFVCM 375

  Fly   580 YVEQFFTK--PI 589
            :.| :.|:  ||
  Fly   376 FAE-YLTRDAPI 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191 3/8 (38%)
Peptidase_C48 396..585 CDD:304959 54/200 (27%)
CG32110NP_729837.1 Peptidase_C48 230..400 CDD:280975 57/208 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5160
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.