DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12717 and ulp-5

DIOPT Version :9

Sequence 1:NP_001285167.1 Gene:CG12717 / 32229 FlyBaseID:FBgn0030420 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_491952.1 Gene:ulp-5 / 186900 WormBaseID:WBGene00006740 Length:311 Species:Caenorhabditis elegans


Alignment Length:267 Identity:69/267 - (25%)
Similarity:117/267 - (43%) Gaps:48/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 LNDIIIDFYL-RWLKNNIIPEEQRDRTHIFSTFFHKRLTT-----RTNPRNTKQTAAQKRHERVE 455
            |||.||:||: .|::..:..|..|..:|:|.:||..::.|     :.||....:.|     ....
 Worm    50 LNDTIIEFYMCDWMRLEVFDEATRASSHVFHSFFLPKIKTCFKDFKENPPRRSELA-----NHYN 109

  Fly   456 KWTRNVN----IFDKDFIIIP--FNEQSHWILAIICYPN---LRSPVVN----NNNVQTT----- 502
            ::.|:.|    ...||.::||  .::..||.|.|:..|:   .|...||    .|.|::.     
 Worm   110 RFFRSKNDAETFLKKDILLIPVHLDKPKHWFLVIVHNPSGAVRRISDVNILDATNKVKSRRLSRR 174

  Fly   503 ----LSDDIPIKQPLILIFDSLAVTSRHRAIAILRDYLTCEHKAKYPNALAHVFNKDNMPGHSVE 563
                ::.|....:..|:|.|||..:.::|.:.......|.:|...:....|...:.|.......:
 Worm   175 ITGHVNCDENAGECRIIIMDSLVHSKKYREVIDKTHDSTFDHIRLWLLMSAAATDVDMFCTRFRK 239

  Fly   564 V-----PQQQNLTDCGLYLLQYVEQFFTKPINDYTLPIKELSNWFDLLTVTKKREDIANLIKKLM 623
            |     |||:|..|||::::.:.| :|||    |....:.|..  |.|...|..:||.:|   |.
 Worm   240 VVCQKLPQQKNSVDCGIFMMAFAE-YFTK----YNTAWQSLPT--DALADLKMDDDIKSL---LN 294

  Fly   624 NESNQQR 630
            :|:.:||
 Worm   295 SETPRQR 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12717NP_001285167.1 BASP1 122..319 CDD:283191
Peptidase_C48 396..585 CDD:304959 54/220 (25%)
ulp-5NP_491952.1 Peptidase_C48 50..302 CDD:367240 69/267 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6692
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.