DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Paics and PUR7

DIOPT Version :9

Sequence 1:NP_572826.1 Gene:Paics / 32228 FlyBaseID:FBgn0020513 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001030739.1 Gene:PUR7 / 821663 AraportID:AT3G21110 Length:411 Species:Arabidopsis thaliana


Alignment Length:319 Identity:87/319 - (27%)
Similarity:127/319 - (39%) Gaps:77/319 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TTTTASIEGYKLGKVIIEGKTKQVYDLPEQPGLCLLLSKDRITAGDGVKAHDLAGKAEISNTTNG 67
            |...|::.|.|..   |:||.:.:||..:   ..:|::.||::|.|    .:||     |....|
plant    97 TNLLATVPGLKSR---IKGKVRDIYDAGD---YLVLITTDRLSAFD----RNLA-----SIPFKG 146

  Fly    68 QVFRLLNEAGI----------RTAYVKQCGAKAFIARKCQMIPIEWVTRRLATGS-----FLKRN 117
            ||   |||..:          ..|.|........||:||.:.|||:|.|...|||     :...|
plant   147 QV---LNETSLWWFNNTQHITPNAIVSSPDRNVVIAKKCSVFPIEFVVRGYVTGSTDTSLWTVYN 208

  Fly   118 VGVPE--GYRFS---------PPKQETFFKDDANHDPQWSEEQIVSAKFELNGLVIGQDEVDIMR 171
            .||..  |...|         |....|.....|:||...|..:||...|      :.|.|.|...
plant   209 KGVRNYCGNELSDGLVKNQKLPANILTPTTKAADHDVPISPNEIVEGGF------MTQAEFDEAS 267

  Fly   172 RTTLLVFEILERAWQTKNCALIDMKVEFGICDDGNIVLADIIDS-DSWRLWPAG--DKRLM---- 229
            ...|.:||..:...:.....|:|.|.|||...||:|:|.|.|.: ||.|.|.||  ::|..    
plant   268 MKALSLFEFGQGVAKKHGLILVDTKYEFGRSSDGSILLIDEIHTPDSSRYWLAGSYEERFQKGLE 332

  Fly   230 ---VDKQVYR-------------NLASVTASDLDTVKRNFIWVAEQLA----DIVPKKD 268
               |||:..|             .|.:..|..:..:...:|::.|.:.    ||:|.::
plant   333 PENVDKEFLRLWFKENCNPYEDEVLPAAPAELVTELAWRYIFLYETITGSRIDIIPTQE 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaicsNP_572826.1 SAICAR_synt_Ade5 12..260 CDD:133471 81/296 (27%)
purE 271..424 CDD:273474
PUR7NP_001030739.1 PLN02544 32..401 CDD:178159 87/319 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 59 1.000 Domainoid score I3919
eggNOG 1 0.900 - - E1_COG0152
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2538
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D566769at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto3499
orthoMCL 1 0.900 - - OOG6_101413
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.