DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Paics and ade7

DIOPT Version :9

Sequence 1:NP_572826.1 Gene:Paics / 32228 FlyBaseID:FBgn0020513 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_595460.1 Gene:ade7 / 2541029 PomBaseID:SPBC409.10 Length:299 Species:Schizosaccharomyces pombe


Alignment Length:289 Identity:63/289 - (21%)
Similarity:119/289 - (41%) Gaps:57/289 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IIEGKTKQVYDLPEQPGLCLLLSKDRITAGDGVKAHDLAGKAEISNTTNGQVFRLLNEAGIRTAY 82
            |..||.:.:|:..|.|...|.::.|||:|.|.:..:.:..|.::....:...|.:| :..::|..
pombe    15 IATGKVRDLYECVEFPDDLLFVATDRISAYDFIMENGIPEKGKVLTKISEFWFDVL-KPHVQTHL 78

  Fly    83 V--------------KQCGAKAFIARKCQMIPIEWVTRRLATGSFLK--------RNVGVPEGYR 125
            :              ::...::.:.:|.:::|||.:.|...|||..|        ..:.||.|.:
pombe    79 ITSRWEELPPVITKHEELKDRSMLVKKYKILPIEAIVRGYITGSAWKEYQKQGTVHGLNVPTGMK 143

  Fly   126 FSPPKQETFF----KDDANHDPQWSEEQIVSAKFELNGLVIGQDEVDIMRRTTLLVFEILERAWQ 186
            .:....|..|    |....||.....:::        ..::|.:....:..|::.:::|......
pombe   144 EAEAFPEPLFTPSTKAAEGHDENIHPDEV--------SKIVGPELAKQVAETSVKLYKIARDVAL 200

  Fly   187 TKNCALIDMKVEFGICDDGN-IVLAD-IIDSDSWRLWPAGDKRL-----MVDKQVYRNLASVTAS 244
            .|...:.|.|.|||:.:..| |||.| ::..||.|.|.|.|..:     ..|||..||.  :||:
pombe   201 KKGIIIADTKFEFGVDETTNKIVLVDEVLTPDSSRFWLASDYTVGKSPDSFDKQYLRNW--LTAN 263

  Fly   245 DL-------------DTVKRNFIWVAEQL 260
            :|             :..:|.::...|.:
pombe   264 NLANKPNVSLPEDVVEATRRKYVEAYEMI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PaicsNP_572826.1 SAICAR_synt_Ade5 12..260 CDD:133471 63/287 (22%)
purE 271..424 CDD:273474
ade7NP_595460.1 SAICAR_synt_Sc 14..294 CDD:133469 63/289 (22%)
PRK13959 17..297 CDD:237570 62/287 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 55 1.000 Domainoid score I3196
eggNOG 1 0.900 - - E1_COG0152
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I2034
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto101538
orthoMCL 1 0.900 - - OOG6_101413
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1036
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.