DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4004 and CG3386

DIOPT Version :9

Sequence 1:NP_727638.2 Gene:CG4004 / 32226 FlyBaseID:FBgn0030418 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001261216.1 Gene:CG3386 / 38081 FlyBaseID:FBgn0035152 Length:288 Species:Drosophila melanogaster


Alignment Length:347 Identity:77/347 - (22%)
Similarity:130/347 - (37%) Gaps:97/347 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FWKKFLGLYRSMPELWLVRSKLYRDRQLKLESYSRLLELLRTTDSYANIHTLKRKINNFRTSYRR 74
            ||::||.||:.|||||.|....||:::|:..:|..|...||.....|....:.|:||.|||:|||
  Fly    16 FWREFLALYQGMPELWDVHHLNYRNKELRNRAYELLERKLREIQPNATRTEVGRRINIFRTNYRR 80

  Fly    75 ELRKVLDS------GNTYKPTLWYFKELDFLYELETGELQLEGIVAADRDLVRNSKVLQNESNKT 133
            |..::|..      .:..|||||::..:.||...||                     .|:.:.|.
  Fly    81 EQMRILKQKELGLHSDLCKPTLWFYDYMGFLLTQET---------------------FQHRTRKG 124

  Fly   134 ITFGAQLAEQEVSMSFIVKREIEVDENITEDMQQLETEDVDIMSDAFPHEEDMLRLDAVGDGDVE 198
             ..|.|..:        .:||                     ..|.:|.:...|..::|.|..::
  Fly   125 -RGGRQKQD--------FRRE---------------------KDDKYPLKNPDLNTESVCDWPIK 159

  Fly   199 PEPEPDNDPELDNMDDHVDDYRNNSSAGSIKNNGYQQHTVSSHQQHNGESQTSDKS--GRRIRNR 261
                          ||:..:|::..:|...:........:...:...|:.:..:::  |..:..:
  Fly   160 --------------DDNAFNYQSEPTAPQSEEGSLLSPKLEIIEPEEGQCEVKEENSLGNSLETK 210

  Fly   262 RRRSSNDTDYVEAARKRRNVETSNRDRDWHRERDRERDRKHESDSEYECELIGKRMASHFRRMRP 326
            ...||..||                     .|.:|.......|:|.   |::.:..|..:..|.|
  Fly   211 EPTSSIQTD---------------------PENERGTAPMQLSESS---EVLARSWAIQYEEMSP 251

  Fly   327 DQRLFAERIISEVLVYGRMNRL 348
            .||:.|.:.|:::|..|.|..|
  Fly   252 TQRILARKAIADILFEGCMGNL 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4004NP_727638.2 MADF_DNA_bdg 14..99 CDD:402258 34/90 (38%)
CG3386NP_001261216.1 MADF_DNA_bdg 20..111 CDD:287510 34/90 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468883
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D114063at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.