DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4004 and CG10904

DIOPT Version :9

Sequence 1:NP_727638.2 Gene:CG4004 / 32226 FlyBaseID:FBgn0030418 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001286800.1 Gene:CG10904 / 37817 FlyBaseID:FBgn0034945 Length:266 Species:Drosophila melanogaster


Alignment Length:212 Identity:55/212 - (25%)
Similarity:85/212 - (40%) Gaps:59/212 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KFLGLYRSMPELWLVRSKLYRDRQLK---LESYSRLLELLRTTDSYANIHTLKRKINNFRTSYRR 74
            |.:.||||...||...|:||:::..:   :||....||:.:        |...:|::|.|..:..
  Fly    31 KLIELYRSSDCLWNHYSELYKNKDCRAKAIESICASLEITK--------HDYGKKVHNLRNQFNA 87

  Fly    75 EL----RKVLDSG---NTYKPTLW-YFKELDFL---YELETGELQLEGIVAADRDLVRNSKVLQN 128
            ||    |::.:||   ::.|...| :||.|.||   .|...|..|    .|..:.||        
  Fly    88 ELKKLERRLEESGGDRDSEKACRWEHFKTLMFLRSVIEPRPGYQQ----GAPGKKLV-------- 140

  Fly   129 ESNKTITFGAQLAEQEVSMSFIVKREIEVDENITEDMQQLETEDVDIMSDAFPHEEDMLRLDAVG 193
             |...:.:..|..|:: |.|.|...|..:.||..|..|..:      :|:..|            
  Fly   141 -SKLDMCYPDQDVEKQ-SQSSIESLESMIIENDAEICQPPK------VSEPIP------------ 185

  Fly   194 DGDVEPEPEPDN---DP 207
              .:.|||.|.:   ||
  Fly   186 --PMPPEPAPSSKFVDP 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4004NP_727638.2 MADF_DNA_bdg 14..99 CDD:402258 27/95 (28%)
CG10904NP_001286800.1 MADF 31..125 CDD:214738 30/101 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468901
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.