DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4004 and CG33017

DIOPT Version :10

Sequence 1:NP_727638.2 Gene:CG4004 / 32226 FlyBaseID:FBgn0030418 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_788375.1 Gene:CG33017 / 36811 FlyBaseID:FBgn0053017 Length:1630 Species:Drosophila melanogaster


Alignment Length:335 Identity:69/335 - (20%)
Similarity:116/335 - (34%) Gaps:92/335 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KRKINNFRTSYRRELRKVLDSGNTYKPTLWYFKEL---------------DFLYELETGELQLEG 111
            ||..|..|.|.||. ||..:.||.:...   :::.               ..:::|:|.:.||..
  Fly   669 KRHQNEERPSKRRS-RKDDEVGNNHNSN---YEDSPPPRRRKDNADEAKNQKVFQLQTDDSQLMA 729

  Fly   112 IVAADR-------------------DLVRNSKVLQNESN--------------KTITFGAQLAEQ 143
            ..|.||                   .:.|||:....|.|              .|.....|.|.:
  Fly   730 CPAYDRRDPKECPHLKCPSPKHREEGVARNSRNRDYEENNERTSKSRRSSPLRNTYNEEEQQAPR 794

  Fly   144 EVSMSFIVKREIEVDENITEDMQQLETEDVDIMSD------AFPHEEDMLRLD------------ 190
            |.|.|...:..........|:.::.:....:|.:|      .|...::..:.:            
  Fly   795 ERSSSHGREDNFRTKRKSNEETKRSKRRSDEICNDETCPFGVFTSRQNKYQSERRTRNSGENEYS 859

  Fly   191 AVGDGDVEPEPEPDNDPELDN-MDDHVDDYRNNSSAGSIKNNGYQQHTVSSHQQHNGESQTSDKS 254
            ..|:|........|||...:| ...:.|....|.:..       ::|:..|:.:.|.|   .:|.
  Fly   860 RHGNGTNPRSKRRDNDNPCNNDTCPYADSLEINMARS-------RKHSDRSYSKENDE---EEKI 914

  Fly   255 GRRIRNR---RRRSSNDTDYVEAARKRRNVETSNRDRDWHRERDRERDRKHESD-SEYECELIGK 315
            .||.|:.   ||||..:.||.:.|:..|      |:.|.:|:..|| |..::|| :||.......
  Fly   915 ARRYRSESSPRRRSRENDDYEDTAKSYR------RESDKYRKPRRE-DPDYDSDYNEYGQRRYNN 972

  Fly   316 RMASHFRRMR 325
            |.:.::...|
  Fly   973 RYSDNYPEYR 982

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4004NP_727638.2 MADF_DNA_bdg 14..99 CDD:463144 11/51 (22%)
CG33017NP_788375.1 MADF_DNA_bdg 21..106 CDD:463144
PTZ00108 <580..830 CDD:240271 31/164 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.