DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4004 and CG33017

DIOPT Version :9

Sequence 1:NP_727638.2 Gene:CG4004 / 32226 FlyBaseID:FBgn0030418 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001286483.1 Gene:CG33017 / 36811 FlyBaseID:FBgn0053017 Length:1630 Species:Drosophila melanogaster


Alignment Length:335 Identity:69/335 - (20%)
Similarity:116/335 - (34%) Gaps:92/335 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KRKINNFRTSYRRELRKVLDSGNTYKPTLWYFKEL---------------DFLYELETGELQLEG 111
            ||..|..|.|.||. ||..:.||.:...   :::.               ..:::|:|.:.||..
  Fly   669 KRHQNEERPSKRRS-RKDDEVGNNHNSN---YEDSPPPRRRKDNADEAKNQKVFQLQTDDSQLMA 729

  Fly   112 IVAADR-------------------DLVRNSKVLQNESN--------------KTITFGAQLAEQ 143
            ..|.||                   .:.|||:....|.|              .|.....|.|.:
  Fly   730 CPAYDRRDPKECPHLKCPSPKHREEGVARNSRNRDYEENNERTSKSRRSSPLRNTYNEEEQQAPR 794

  Fly   144 EVSMSFIVKREIEVDENITEDMQQLETEDVDIMSD------AFPHEEDMLRLD------------ 190
            |.|.|...:..........|:.::.:....:|.:|      .|...::..:.:            
  Fly   795 ERSSSHGREDNFRTKRKSNEETKRSKRRSDEICNDETCPFGVFTSRQNKYQSERRTRNSGENEYS 859

  Fly   191 AVGDGDVEPEPEPDNDPELDN-MDDHVDDYRNNSSAGSIKNNGYQQHTVSSHQQHNGESQTSDKS 254
            ..|:|........|||...:| ...:.|....|.:..       ::|:..|:.:.|.|   .:|.
  Fly   860 RHGNGTNPRSKRRDNDNPCNNDTCPYADSLEINMARS-------RKHSDRSYSKENDE---EEKI 914

  Fly   255 GRRIRNR---RRRSSNDTDYVEAARKRRNVETSNRDRDWHRERDRERDRKHESD-SEYECELIGK 315
            .||.|:.   ||||..:.||.:.|:..|      |:.|.:|:..|| |..::|| :||.......
  Fly   915 ARRYRSESSPRRRSRENDDYEDTAKSYR------RESDKYRKPRRE-DPDYDSDYNEYGQRRYNN 972

  Fly   316 RMASHFRRMR 325
            |.:.::...|
  Fly   973 RYSDNYPEYR 982

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4004NP_727638.2 MADF_DNA_bdg 14..99 CDD:402258 11/51 (22%)
CG33017NP_001286483.1 MADF_DNA_bdg 21..106 CDD:287510
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468905
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.