DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4004 and CG15601

DIOPT Version :9

Sequence 1:NP_727638.2 Gene:CG4004 / 32226 FlyBaseID:FBgn0030418 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_573058.1 Gene:CG15601 / 32509 FlyBaseID:FBgn0030673 Length:277 Species:Drosophila melanogaster


Alignment Length:336 Identity:74/336 - (22%)
Similarity:122/336 - (36%) Gaps:101/336 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KFLGLYRSMPELWLVRSKLYRDRQLKLESYSRLLELLRTTDSYANIHTLKRKINNFRTSYRRELR 77
            :||..||..|.|:......|::|..:.|:|..::..|:...  ..:..:|.||.:.||.|.:|||
  Fly    13 EFLEAYRRQPCLYNTLLDSYKNRVSREEAYGAIIRSLKIPQ--LTVSDIKLKIKSVRTVYSKELR 75

  Fly    78 ---KVLDSGNTYKPTLWYFKELD-FLYELETGELQLEGIVAADRDLVRNSKVLQNESNKTITFGA 138
               :..:.|.||:|.|::|:..| ||..:.....:.:|               :|.|:     .|
  Fly    76 IWMREKELGRTYEPKLFWFRLADSFLRSVSLSHCKRQG---------------KNNSS-----SA 120

  Fly   139 QLAEQEVSMSFIVKREIEVDENITEDMQQLETEDVDIMSDAFPHEEDMLRLDAVGDGDVEPEPEP 203
            ||.            .|:.||  |..:......|:.:..||...|      ||..:|:.|..|..
  Fly   121 QLT------------TIKSDE--TSKLLCTAAADITMSEDALEEE------DAEVNGEPEECPLE 165

  Fly   204 DNDPELDNMDDHVDDYRNNSSAGSIKNNGYQQHTVSSHQQHNGESQTSDKSGRRIRNRRRRSSND 268
            ::.|                :|...|::..........|:|..:..:              ||..
  Fly   166 ESRP----------------TASICKDDSTLCLADQPQQEHYSQGCS--------------SSQQ 200

  Fly   269 TDYVEAARKRRNVETSNRDRDWHRERDRERDRKHESDSEYECELI--GKRMASHFRRMRPD--QR 329
            ..:..|.||.:.:.:                    .||..|.:||  |:.:||..|.: ||  .|
  Fly   201 LPHTMAQRKSKYITS--------------------LDSAGEDDLIIFGQSIASQLRTI-PDSYSR 244

  Fly   330 LFAERIISEVL 340
            ..|:..|.:||
  Fly   245 SVAKLRIQQVL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4004NP_727638.2 MADF_DNA_bdg 14..99 CDD:402258 27/88 (31%)
CG15601NP_573058.1 MADF_DNA_bdg 14..101 CDD:287510 27/88 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468892
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009991
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.