DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4004 and CG30403

DIOPT Version :9

Sequence 1:NP_727638.2 Gene:CG4004 / 32226 FlyBaseID:FBgn0030418 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_726108.3 Gene:CG30403 / 246595 FlyBaseID:FBgn0050403 Length:302 Species:Drosophila melanogaster


Alignment Length:211 Identity:51/211 - (24%)
Similarity:76/211 - (36%) Gaps:51/211 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KFLGLYRSMPELWLVRSKLYRDRQLKLESYSRLLELLRTT----DSYANIHTLKRKINNFRTSYR 73
            ||:.||...|.||..|..|.|.|.   .:|.|:...:...    :|...|..:|.||.|.||.|.
  Fly    23 KFVELYGREPCLWNKRPYLRRARS---AAYRRIQSGINADIEPYESGLTIQGVKMKIKNLRTGYH 84

  Fly    74 RELRKVLDSGNTYKPTLWYFKELDFLYE-LETGELQLEGIVAADRDLVRNSKVLQNESNKTITFG 137
            :||:|:.........|.|:.....||.| |:|.||:                          |..
  Fly    85 QELKKIRTIPGYQPKTPWFAPLHGFLAEFLDTNELE--------------------------TSI 123

  Fly   138 AQLAEQEVSMSFIVKREIEVDENITEDMQQLETED----------VDIMSDAFPHEEDML---RL 189
            .||...::.::.:  :.|::...|..|...|...|          ..::....|.||...   .:
  Fly   124 PQLKRLQIRLTRL--KPIKIQTEIKPDPDDLSVPDRPLDATPSSLFTVLPAPMPVEEPPTPPPSV 186

  Fly   190 DAVGD--GDVEPEPEP 203
            ..:||  ..|.|:|.|
  Fly   187 PKIGDIISPVHPDPAP 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4004NP_727638.2 MADF_DNA_bdg 14..99 CDD:402258 26/88 (30%)
CG30403NP_726108.3 GT1 24..103 CDD:304916 25/81 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009991
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.