DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4004 and CG5180

DIOPT Version :9

Sequence 1:NP_727638.2 Gene:CG4004 / 32226 FlyBaseID:FBgn0030418 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001138087.1 Gene:CG5180 / 192508 FlyBaseID:FBgn0043457 Length:355 Species:Drosophila melanogaster


Alignment Length:396 Identity:86/396 - (21%)
Similarity:147/396 - (37%) Gaps:121/396 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KFLGLYRSMPELWLVRSKLYRDRQLKLESYSRLLELLRTTDSYANIHTLKRKINNFRTSYRRELR 77
            :|:..|:....||..:...|.:...:.:||.||:|.|:..:...:...:.||||:.|:::|||.|
  Fly    15 EFIEQYQEEECLWQPKHNDYSNHTARNKSYDRLVEKLKEVEPNPDRAMVVRKINSLRSAFRREFR 79

  Fly    78 KVLDSGNTYKPTLWYFKELDFLYELETGELQLEGIVAADRDLVRNSKVLQNESNKTITFGAQLAE 142
            |....|: |...|||:.:|.|:               ||....|:....:.:....|:|     :
  Fly    80 KTSTKGD-YATRLWYYDKLLFI---------------ADHKPKRHELGSKPKRELHISF-----D 123

  Fly   143 QEVSMSFIVKREIEVDENITEDMQQLETEDVDIMSDAFPHEEDMLRLDAVGDGDVEPEPEPDNDP 207
            .|.||.|      |.|.:.|....|              |.|.::             |...:|.
  Fly   124 DEESMEF------EDDSHHTGTQSQ--------------HMESII-------------PTSPDDV 155

  Fly   208 ELDNMDDHVDDYRNN---SSAGS---------------IKNNGYQ-----QHTVSSHQQ--HNGE 247
            |      .|....||   ||.|:               :|:..:|     .....:|||  .:..
  Fly   156 E------EVAATANNVVVSSQGATLSTISVTPAECVTLVKSEEHQAAEAAAAAAQAHQQMVAHAA 214

  Fly   248 SQTS----DKSGRRIR---------NRRRRSSNDTDYVEAARKRRNVETSNRD----------RD 289
            :|||    ...|..::         |.:|......:::|..:::.:::.:|..          ||
  Fly   215 AQTSIAAAAAQGHAVKVLEITSLDSNSQREIQQAVNHLEHHQQQLHLQQTNGQHQGVPTIQIGRD 279

  Fly   290 WHR-----------ERDRERDRKHESDSEYECELIGKRMASHFRRMRPDQRLFAERIISEVLVYG 343
            .::           .........|..|.||:.  ||..:||..|.:.|.||:.||::||:||...
  Fly   280 HYQPLFGNAGTTAYTTTAATSTSHRQDDEYDA--IGVNVASKLRSINPTQRIVAEKLISDVLFNA 342

  Fly   344 RMNRLS 349
            ::..|:
  Fly   343 QLGNLT 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4004NP_727638.2 MADF_DNA_bdg 14..99 CDD:402258 27/84 (32%)
CG5180NP_001138087.1 MADF_DNA_bdg 16..100 CDD:287510 27/84 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468895
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009991
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.