DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4004 and LOC101733005

DIOPT Version :9

Sequence 1:NP_727638.2 Gene:CG4004 / 32226 FlyBaseID:FBgn0030418 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_004919501.1 Gene:LOC101733005 / 101733005 -ID:- Length:332 Species:Xenopus tropicalis


Alignment Length:354 Identity:83/354 - (23%)
Similarity:139/354 - (39%) Gaps:112/354 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DFWKKFLGLYRSMPELWLVRSKLYRDRQLKLESYSRLLELLRTTDSYANIHTLKRKINNFRTSYR 73
            :|.::|:.||:|.|.||.|:|..|.:|..:.::|:.|:.|.::..|.|::..:|.||.|.||.::
 Frog     8 EFLREFIELYQSFPCLWKVKSGDYMNRIKRDKAYAELISLCKSVCSSADLQHVKTKIANLRTVFK 72

  Fly    74 RELRKV-------LDSGNTYKPTLWYFKELDFLYELETGELQLEGIVAADRDLVRNSKVLQNESN 131
            :|:.||       ..:.:.|.|.|||:..|.|               ..|:::.|:|:  .|.||
 Frog    73 KEMNKVQASKKSGASADDIYVPRLWYYDLLVF---------------TVDQEVARDSR--SNFSN 120

  Fly   132 KTITFGAQLAEQEVSMSFIVKREIEVDENITEDMQQLETEDVDIMSDAFPHEEDMLRLDAVGDGD 196
                                              |.||.:.   .::|.|.|            |
 Frog   121 ----------------------------------QGLEKQQ---STEASPAE------------D 136

  Fly   197 VEPEPEPDNDPELDNMDDHVDDYRNNSSAGSIKNNGYQQHTVSSHQQHNGESQTSDKSGRRIRNR 261
            |..:.....|.|:::..:|:.....:|:            .:....||    :.:...|.:.|||
 Frog   137 VTAQSSRAADIEVEDQTEHLAQIPQSST------------LIEEGSQH----EMAGAKGSQGRNR 185

  Fly   262 RRRSSNDTDYVEAARKRRNVETSNRDRDWHRERDRERDRKHESDSEYECELIGKRMASHFRRMRP 326
            :|:::..|..:                    ..|.|.....:||   |.:.||..:||..|||..
 Frog   186 KRKNNPSTQQL--------------------LHDAETLLNTKSD---EFDAIGFTVASKLRRMDE 227

  Fly   327 DQRLFAERIISEVLVYGRMNRLSFETQFS 355
            :||.|||.||:|.|..|....|...|:.:
 Frog   228 EQRQFAEYIINEALHRGFRKTLRESTRLT 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4004NP_727638.2 MADF_DNA_bdg 14..99 CDD:402258 31/91 (34%)
LOC101733005XP_004919501.1 MADF_DNA_bdg 13..104 CDD:287510 31/90 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1381134at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.