DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4004 and LOC101731991

DIOPT Version :9

Sequence 1:NP_727638.2 Gene:CG4004 / 32226 FlyBaseID:FBgn0030418 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_017953148.2 Gene:LOC101731991 / 101731991 -ID:- Length:356 Species:Xenopus tropicalis


Alignment Length:355 Identity:84/355 - (23%)
Similarity:141/355 - (39%) Gaps:111/355 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DFWKKFLGLYRSMPELWLVRSKLYRDRQLKLESYSRLLELLRTTDSYANIHTLKRKINNFRTSYR 73
            :|.::|:.||:|.|.||.|:|..|.:|..:.::|:.|:.|.::..|.|::..:|.||.|.||.::
 Frog    29 EFLREFIELYQSFPCLWKVKSGDYMNRIKRDKAYAELISLCKSVCSSADLQYVKTKIANLRTVFK 93

  Fly    74 RELRKV-------LDSGNTYKPTLWYFKELDFLYELETGELQLEGIVAADRDLVRNSKVLQNESN 131
            :|:.||       ..:.:.|.|.|||:..|.|               ..|:::.|:|:  .|.||
 Frog    94 KEMNKVQASKKSGASADDIYVPRLWYYDLLVF---------------TVDQEVARDSR--SNFSN 141

  Fly   132 KTITFGAQLAEQEVSMSFIVKREIEVDENITEDMQQLETEDVDIMSDAFPHEEDMLRLDAVGDGD 196
                                              |.||.:.   .::|.|.|:..         |
 Frog   142 ----------------------------------QGLEKQQ---STEASPAEDVT---------D 160

  Fly   197 VEPEPEPDNDPELDNMDDHVDDYRNNSSAGSIKNNGYQQHTVSSHQQHNGESQTSDKSGRRIRNR 261
            |..:.....|.|:::..:|:.....:|:            .:....||    :.:...|.:.|||
 Frog   161 VTAQSSRAADIEVEDQTEHLAQIPQSST------------LIEEGSQH----EMAGAKGTQGRNR 209

  Fly   262 RRRSSNDTDYVEAARKRRNVET-SNRDRDWHRERDRERDRKHESDSEYECELIGKRMASHFRRMR 325
            :|:::..|..:     ..:.|| .||..|                   |.:.||..:||..|||.
 Frog   210 KRKNNPSTQQL-----LHDAETLLNRKSD-------------------EFDAIGFTVASKLRRMD 250

  Fly   326 PDQRLFAERIISEVLVYGRMNRLSFETQFS 355
            .:||.|||.||:|.|..|....|...|:.:
 Frog   251 EEQRQFAEYIINEALHRGFRKTLRESTRLT 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4004NP_727638.2 MADF_DNA_bdg 14..99 CDD:402258 31/91 (34%)
LOC101731991XP_017953148.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1381134at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.