DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15725 and Bach2

DIOPT Version :9

Sequence 1:NP_572823.1 Gene:CG15725 / 32224 FlyBaseID:FBgn0030417 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_001129226.1 Gene:Bach2 / 313125 RGDID:1562865 Length:839 Species:Rattus norvegicus


Alignment Length:561 Identity:109/561 - (19%)
Similarity:169/561 - (30%) Gaps:196/561 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 DVILEVGPAPSNVRFVAHSLVLGMHSGYLRSAIRLDETAAGTAASVSASASISITGATAASCNPS 113
            |::.:|........|.||..||...|.|...|:                                
  Rat    34 DILCDVTLIVERKEFRAHRAVLAACSEYFWQAL-------------------------------- 66

  Fly   114 SSSSAASSSSSAVTTASGELLLYL-SNVTADQFAPLLTYMYTGYLDLNVDNIFAVLLATHVLHMP 177
                        |.....:|::.| ..|||..|.|||.:.||..|.|:.:||..|:.....|.|.
  Rat    67 ------------VGQTKDDLVVSLPEEVTARGFGPLLQFAYTAKLLLSRENIREVIRCAEFLRMH 119

  Fly   178 RALEICRSFLARAQTEGYLN---------------------GNPAA------------------- 202
            ...:.|.|||   ||: .||                     ||.|.                   
  Rat   120 NLEDSCFSFL---QTQ-LLNREDGLFVCRKDSACQRPQEDHGNSAGEEEEEEETMDSETARMACA 180

  Fly   203 --QLCPVP-SIPAKIIRPIPSKATMPNFGFLPLPQAPPSVAPSAQPTA--HQP---------TTG 253
              |:.|.| |..|..| |:..|..    ..||..:.|.....:::..|  ..|         |..
  Rat   181 TDQMLPDPISFEATAI-PVAEKEE----ALLPESEVPTDTKENSEKGALTQYPRYKKYQLACTKN 240

  Fly   254 IAPVASASILSSFGTNTQHMEHMEQPIAML--------------DNEVDEEDVEVFIDSNTVTDN 304
            :...||.......||.::     |.|...|              :.|.:||.:.:.:..:   :.
  Rat   241 VYSAASHGTSGFAGTFSE-----ESPGNSLKPGLSVGQIKSEPPNEETEEESITLCLSGD---ET 297

  Fly   305 EAEELEPDVDMDCNVSVVSSLAASSAGSMNIERLDVKPPTPIPVSVATIISATTTKSQAQSLGQS 369
            :.::...||:|                       |.|.|:|.|        ...|.:.|.||   
  Rat   298 DIKDRPGDVEM-----------------------DRKQPSPAP--------PPGTPTGATSL--- 328

  Fly   370 KGQNSRRESNSKGNRTKSSASRSRKSSGLQVAKAPVPAAQLDLTAAATP---SITSSKFIIDVAS 431
              ..||..|:....|:..|.::..:|:||     |..:.|..:.::|.|   .|:......|...
  Rat   329 --DRSRSVSSPSCLRSLFSIAKGVESTGL-----PSTSQQHFVRSSACPFNKGISQGDLKTDYTP 386

  Fly   432 CDGPVRFRRILNTAYGHKPEAMESNALAGPATAPAGGSSNSTISEQHRSQQSVSLSFHQQMA--- 493
            ..|        |....|..:...||...|   :|..|....|:.:|.......|:.|.....   
  Rat   387 LAG--------NYGQPHVGQKDVSNFAMG---SPLRGPGPETLCKQEGELDRRSVIFSASTCDQP 440

  Fly   494 -------RAISSQQRQLSHQQQEES-ENSGDAIPATIGKQH 526
                   .::||..:.||....:.. ..:|.::|::....|
  Rat   441 NTPVHSYSSVSSLDKDLSEPVPKSLWVGAGQSLPSSQAYSH 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15725NP_572823.1 BTB 49..189 CDD:197585 33/140 (24%)
BTB 49..187 CDD:279045 31/138 (22%)
zf-C2H2 573..595 CDD:278523
Bach2NP_001129226.1 BTB_POZ_BACH2 6..129 CDD:349587 31/138 (22%)
bZIP_BACH 639..709 CDD:269867
coiled coil 648..699 CDD:269867
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46105
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.