DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15725 and NACC2

DIOPT Version :9

Sequence 1:NP_572823.1 Gene:CG15725 / 32224 FlyBaseID:FBgn0030417 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_653254.1 Gene:NACC2 / 138151 HGNCID:23846 Length:587 Species:Homo sapiens


Alignment Length:476 Identity:90/476 - (18%)
Similarity:149/476 - (31%) Gaps:169/476 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 FVAHSLVLGMHSGYLRSAIRLDETAAGTAASVSASASISITGATAASCNPSSSSSAASSSSSAVT 127
            |.||..||...|.|.|...           |.::.::..:.|:...:|                 
Human    41 FKAHRAVLAASSLYFRDLF-----------SGNSKSAFELPGSVPPAC----------------- 77

  Fly   128 TASGELLLYLSNVTADQFAPLLTYMYTGYLDLNVDNIFAVLLATHVLHMPRALE----------- 181
                             |..:|::.|||.|.:.......|:.....|.:...:|           
Human    78 -----------------FQQILSFCYTGRLTMTASEQLVVMYTAGFLQIQHIVERGTDLMFKVSS 125

  Fly   182 -ICRSFLARAQTEGYLNGNPAAQLCPV----------PSIPAKIIRPIPSKATMPNFGFLPLPQA 235
             .|.|..|..:..|....:|..||.|.          ||:|..::..:..:|       :.||.|
Human   126 PHCDSQTAVIEDAGSEPQSPCNQLQPAAAAAAPYVVSPSVPIPLLTRVKHEA-------MELPPA 183

  Fly   236 PPSVAPSAQPTAHQPTTGIAPVASASI----------------LSSFGTNTQHMEHMEQP----- 279
            .|.:||. :|....|..|:|..|.|::                :.|..|....::.|..|     
Human   184 GPGLAPK-RPLETGPRDGVAVAAGAAVAAGTAPLKLPRVSYYGVPSLATLIPGIQQMPYPQGERT 247

  Fly   280 ------IAMLD------NEVDEEDVEVFIDSNTVTDNEAEELEPDVDMDCNVSVVSSLAASSAGS 332
                  :...|      ||.||||.|.:       |...||            ....:...::||
Human   248 SPGASSLPTTDSPTSYHNEEDEEDDEAY-------DTMVEE------------QYGQMYIKASGS 293

  Fly   333 MNIERLDVKPPTPIPV-SVATIISATTTKSQAQSLGQSKGQNSRRESNSKGNRTKSSASRSRKSS 396
            ..::    :.|.|:|: |.:.::......:...||....|.....:..|:|:             
Human   294 YAVQ----EKPEPVPLESRSCVLIRRDLVALPASLISQIGYRCHPKLYSEGD------------- 341

  Fly   397 GLQVAKAPVPAAQLDLTAAATPSITSSKFIIDVASCDG---PVRFRRILNTAYGHKPEAMESNAL 458
                     |..:|:|.|.:...||..: :::...|.|   .|..||:|.|.:       :.|.|
Human   342 ---------PGEKLELVAGSGVYITRGQ-LMNCHLCAGVKHKVLLRRLLATFF-------DRNTL 389

  Fly   459 AGPATAPAGGSSNSTISEQHR 479
            |.    ..|....|:.|:..|
Human   390 AN----SCGTGIRSSTSDPSR 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15725NP_572823.1 BTB 49..189 CDD:197585 22/137 (16%)
BTB 49..187 CDD:279045 22/135 (16%)
zf-C2H2 573..595 CDD:278523
NACC2NP_653254.1 BTB 20..120 CDD:279045 20/123 (16%)
BTB 31..114 CDD:197585 19/117 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..272 7/31 (23%)
BEN 373..450 CDD:214981 12/45 (27%)
TIM_phosphate_binding 496..>581 CDD:304361
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 542..587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46105
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.