| Sequence 1: | NP_572823.1 | Gene: | CG15725 / 32224 | FlyBaseID: | FBgn0030417 | Length: | 745 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031746625.1 | Gene: | zbtb7b / 100494312 | XenbaseID: | XB-GENE-5727011 | Length: | 482 | Species: | Xenopus tropicalis |
| Alignment Length: | 246 | Identity: | 51/246 - (20%) |
|---|---|---|---|
| Similarity: | 77/246 - (31%) | Gaps: | 81/246 - (32%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 143 DQFAPLLTYMYTGYLDLNVDNIFAVLLATHVLHMPRALEICRSFL-------------------- 187
Fly 188 -ARAQTEGYL---NGNPAA---QLCPVPSIPAKIIRPIPSKAT--MPNFG---FLPL-PQ----- 234
Fly 235 ---------------------APPSVAPSAQPTAHQ----------PTTGIAPVASASILSSFGT 268
Fly 269 NTQHMEHMEQPIAMLDNEVDEEDVEVFIDSNTVTDNEAEELEPDVDMDCNV 319 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG15725 | NP_572823.1 | BTB | 49..189 | CDD:197585 | 14/66 (21%) |
| BTB | 49..187 | CDD:279045 | 13/43 (30%) | ||
| zf-C2H2 | 573..595 | CDD:278523 | |||
| zbtb7b | XP_031746625.1 | BTB_POZ_ZBTB7B_ZBTB15 | 9..129 | CDD:349636 | 13/44 (30%) |
| COG5048 | <233..418 | CDD:227381 | 17/95 (18%) | ||
| C2H2 Zn finger | 315..335 | CDD:275368 | 2/3 (67%) | ||
| zf-H2C2_2 | 330..352 | CDD:404364 | |||
| C2H2 Zn finger | 343..363 | CDD:275368 | |||
| zf-H2C2_2 | 356..380 | CDD:404364 | |||
| C2H2 Zn finger | 371..391 | CDD:275368 | |||
| zf-H2C2_2 | 383..408 | CDD:404364 | |||
| C2H2 Zn finger | 399..417 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR46105 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||