DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tis11 and AT1G68200

DIOPT Version :9

Sequence 1:NP_001259490.1 Gene:Tis11 / 32222 FlyBaseID:FBgn0011837 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_001319344.1 Gene:AT1G68200 / 843149 AraportID:AT1G68200 Length:308 Species:Arabidopsis thaliana


Alignment Length:220 Identity:65/220 - (29%)
Similarity:93/220 - (42%) Gaps:39/220 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NDHLGDFDCNEVRKEIRMLLAHGANLDQQHQQQP-------HRHHGGLTRTISQPAQLIQQQQQQ 87
            |..:|..|.:||..:.|.:     |.|..:.:.|       ..:...|.::||..:....:..|.
plant   109 NLSIGGNDADEVENQNRTV-----NRDDVNDKSPTSVMENEDLNRSSLPKSISVRSNGYSKASQG 168

  Fly    88 HQQQQQQQPAVASLVTITENLGNMNLHRKL-------ERTQSEPLPPQQPMNTSRYKTELCRPFE 145
            ......|.......||.....|.::..:|:       :..|.|.: ..:..|....|||||..::
plant   169 GGGAAAQSGKPRGTVTKPGTCGQVSTTQKVYVRGGGKKEDQEEEI-EVEVYNQGMTKTELCNKWQ 232

  Fly   146 EAGECKYGEKCQFAHGSHELRNVHRHPKYKTEYCRTFHSVGFCPYGPRCHFVHNADEARAQQAAQ 210
            |.|.|.||:.||||||..|||.|.|||:||||.||...:...||||.||||.|            
plant   233 ETGTCPYGDHCQFAHGIKELRPVIRHPRYKTEVCRMVLAGDNCPYGHRCHFRH------------ 285

  Fly   211 AAKSSTQSQSQSQQSSSQNFSPKSN 235
                   |.|:.::..:..|.|||:
plant   286 -------SLSEQEKLVAAGFKPKSS 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tis11NP_001259490.1 zf-CCCH 136..161 CDD:279036 14/24 (58%)
zf-CCCH 174..198 CDD:279036 14/23 (61%)
AT1G68200NP_001319344.1 CTH1 <220..>302 CDD:227395 42/100 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5063
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000616
OrthoInspector 1 1.000 - - otm3212
orthoMCL 1 0.900 - - OOG6_101179
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.