DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tis11 and AT1G04990

DIOPT Version :9

Sequence 1:NP_001259490.1 Gene:Tis11 / 32222 FlyBaseID:FBgn0011837 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_001318923.1 Gene:AT1G04990 / 839351 AraportID:AT1G04990 Length:404 Species:Arabidopsis thaliana


Alignment Length:160 Identity:40/160 - (25%)
Similarity:58/160 - (36%) Gaps:40/160 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 LHRKLERTQSEPLPPQQPMNTSRYKTELCRPFEEAGECKYGEKCQFAHGSHELRNVHRHPKYKTE 177
            |:|.|..:..:|               .||.|...|.||||:.|:::|..  :|.....|.....
plant   254 LNRGLSESSDQP---------------ECRFFMNTGTCKYGDDCKYSHPG--VRISQPPPSLINP 301

  Fly   178 Y----------CRTFHSVGFCPYGPRCHFVHNADEARAQQAAQAAKSSTQSQSQSQQSSSQNFSP 232
            :          |..|.|.|||.:||.|.|    |............:|..:...|..::.|..||
plant   302 FVLPARPGQPACGNFRSYGFCKFGPNCKF----DHPMLPYPGLTMATSLPTPFASPVTTHQRISP 362

  Fly   233 KSNQSSNQS-SN--------SSSSSSSSGG 253
            ..|:|.::| ||        ||.:.....|
plant   363 TPNRSDSKSLSNGKPDVKKESSETEKPDNG 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tis11NP_001259490.1 zf-CCCH 136..161 CDD:279036 9/24 (38%)
zf-CCCH 174..198 CDD:279036 10/33 (30%)
AT1G04990NP_001318923.1 zf-CCCH 48..73 CDD:395517
zf-CCCH 92..117 CDD:395517
zf-CCCH 137..162 CDD:395517
YTH1 <261..403 CDD:227416 37/153 (24%)
zf-CCCH 263..287 CDD:395517 10/38 (26%)
zf-CCCH 308..334 CDD:395517 11/29 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5063
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.