DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tis11 and AT5G63260

DIOPT Version :9

Sequence 1:NP_001259490.1 Gene:Tis11 / 32222 FlyBaseID:FBgn0011837 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_001190604.1 Gene:AT5G63260 / 836446 AraportID:AT5G63260 Length:451 Species:Arabidopsis thaliana


Alignment Length:261 Identity:60/261 - (22%)
Similarity:81/261 - (31%) Gaps:88/261 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 RYKTELCRPFEEAGECKYGEKCQFAH------------GSHELRNVHRH---------------P 172
            |..:|.|..:...|.||||..|:|.|            ||...||...:               |
plant   101 RPDSEDCSFYMRTGSCKYGSSCKFNHPVRRKLQDLKFLGSMRTRNGKEYIGRERVRERDEDVENP 165

  Fly   173 KYKTEYCRTFHSVGFCPYGPRCHFVHNADEARAQQAAQAAKSSTQSQSQSQQSSSQ-NF-----S 231
            |...  |:.:...|.|.||..|.|.|                  ..:..|..|..: ||     .
plant   166 KLME--CKYYFRTGGCKYGESCRFSH------------------MKEHNSPASVPELNFLGLPIR 210

  Fly   232 PKSNQSSNQSSNSSSSSSS---------SGGGGGGGNSINNNNGSQFYLPLSPPLSMST--GSDR 285
            |...:......|.|....|         :..||........|||..| .|.:|..:.||  .|.|
plant   211 PGEKECPFYMRNGSCKFGSDCKFNHPDPTAIGGVDSPLYRGNNGGSF-SPKAPSQASSTSWSSTR 274

  Fly   286 E-SPTGSLSLSPTNSLTSFPFHDALQ------HGY------------LASNGAKSNSSASSTSSA 331
            . :.||:....|    :.||....:.      :||            ||.:..:.|:|.:.|||.
plant   275 HMNGTGTAPFIP----SMFPHSRGVTPQASDWNGYQASSAYPPERSPLAPSSYQVNNSLAETSSF 335

  Fly   332 S 332
            |
plant   336 S 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tis11NP_001259490.1 zf-CCCH 136..161 CDD:279036 10/36 (28%)
zf-CCCH 174..198 CDD:279036 7/23 (30%)
AT5G63260NP_001190604.1 zf-CCCH 102..128 CDD:279036 10/25 (40%)
zf-CCCH 169..191 CDD:279036 8/41 (20%)
zf-CCCH 211..237 CDD:279036 4/25 (16%)
zf-CCCH 351..377 CDD:279036
zf-CCCH 402..422 CDD:279036
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5063
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.