DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tis11 and AT5G18550

DIOPT Version :9

Sequence 1:NP_001259490.1 Gene:Tis11 / 32222 FlyBaseID:FBgn0011837 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_197356.2 Gene:AT5G18550 / 831973 AraportID:AT5G18550 Length:465 Species:Arabidopsis thaliana


Alignment Length:212 Identity:55/212 - (25%)
Similarity:81/212 - (38%) Gaps:46/212 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 RTQSEPLPPQQPMNTSRYKTELCRPFEEAGECKYGEKCQFAH----GSHE---LRNVHRHPKYKT 176
            :.|:.|..|:||.         |:.|...|:||:|..|:|.|    .|.|   |.::....:...
plant   293 KEQTFPQRPEQPE---------CQYFMRTGDCKFGTSCRFHHPMEAASPEASTLSHIGLPLRPGA 348

  Fly   177 EYCRTFHSVGFCPYGPRCHFVHNADEARAQQAAQAAKSSTQSQSQSQQSSSQNFSPKSNQSSNQS 241
            ..|..|...|.|.:||.|.|.|:...: :...:.:..|.|........||....:|.|  ||:|.
plant   349 VPCTHFAQHGICKFGPACKFDHSLGSS-SLSYSPSPSSLTDMPVAPYPSSLGTLAPSS--SSDQC 410

  Fly   242 SNSSSSSSSSGGGGGGGNSINNNNGSQFYLPLSPPLSMSTGSDRESPTGSLSLSPTNSLTSFPFH 306
            :...||||..                        |::.:||.   |.|.:..:|...|..|.|..
plant   411 TELISSSSIE------------------------PITTTTGG---SETVAAGVSSMTSDVSHPEP 448

  Fly   307 DALQHGYLASNGAKSNS 323
            .....|..|||.||::|
plant   449 AETNKGDSASNEAKTSS 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tis11NP_001259490.1 zf-CCCH 136..161 CDD:279036 9/28 (32%)
zf-CCCH 174..198 CDD:279036 8/23 (35%)
AT5G18550NP_197356.2 zf-CCCH 52..78 CDD:395517
zf-CCCH 99..124 CDD:395517
zf-CCCH 146..172 CDD:395517
zf-CCCH 301..327 CDD:395517 12/34 (35%)
zf-CCCH 346..370 CDD:395517 8/23 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5063
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.