DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tis11 and AT5G06770

DIOPT Version :10

Sequence 1:NP_511141.2 Gene:Tis11 / 32222 FlyBaseID:FBgn0011837 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_196295.1 Gene:AT5G06770 / 830566 AraportID:AT5G06770 Length:240 Species:Arabidopsis thaliana


Alignment Length:73 Identity:26/73 - (35%)
Similarity:41/73 - (56%) Gaps:5/73 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 QQPAVASLVTITENLGNMNLHRKLERTQSEPLPPQQPMNTSRYKTELCRPFEEAGECKYGEKCQF 158
            :|..|||.: :.|.:|.:.   .:::.|....|..:|...|.|||::|..:.: |.|.||::|.|
plant   168 EQINVASGM-VRELIGRLG---SVKKPQGIGGPEGKPHPGSNYKTKICDRYSK-GNCTYGDRCHF 227

  Fly   159 AHGSHELR 166
            |||..|||
plant   228 AHGESELR 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tis11NP_511141.2 CTH1 <121..>198 CDD:227395 20/46 (43%)
AT5G06770NP_196295.1 ZnF_C3H1 37..61 CDD:214632
KH-I_AtC3H36_like 116..181 CDD:411892 5/13 (38%)
ZnF_C3H1 205..231 CDD:214632 12/26 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.