DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tis11 and OZF2

DIOPT Version :9

Sequence 1:NP_001259490.1 Gene:Tis11 / 32222 FlyBaseID:FBgn0011837 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_194648.1 Gene:OZF2 / 829040 AraportID:AT4G29190 Length:356 Species:Arabidopsis thaliana


Alignment Length:188 Identity:53/188 - (28%)
Similarity:75/188 - (39%) Gaps:44/188 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 YKTELCRPFEEAGECKYGEKCQFAHGSHELRNVHRHP-KYKTEYCRTFHSVGFCPYGPRCHFVHN 199
            |....|..|.:.| ||.|:.|:||||..|   ...|| :|:|:.|:   ..|.| ....|.|.|:
plant   120 YSGTACPDFRKGG-CKKGDSCEFAHGVFE---CWLHPARYRTQPCK---DGGNC-LRKICFFAHS 176

  Fly   200 ADEAR-----------AQQAAQAAKSSTQSQSQSQQSSSQNFSPKSNQSSNQSSNSSSSSSSSGG 253
            .|:.|           :...:...::.....|.|..|.|...||:::..|:..:.|.|.|.    
plant   177 PDQLRFLHTRSPDRVDSFDVSSPIRARAFQLSISPVSGSPPMSPRADSESSPMTQSLSRSL---- 237

  Fly   254 GGGGGNSINN----------NNGSQFYLPLSPPLSMSTGSDRESPTG----SLSLSPT 297
               |..|||:          |:...|  |.:.|| ...||.|.|..|    ||..:||
plant   238 ---GSCSINDVVPSFRNLQFNSVKSF--PRNNPL-FGFGSPRGSILGPGFQSLPTTPT 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tis11NP_001259490.1 zf-CCCH 136..161 CDD:279036 10/24 (42%)
zf-CCCH 174..198 CDD:279036 7/23 (30%)
OZF2NP_194648.1 ZnF_C3H1 120..144 CDD:214632 10/24 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I2649
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
22.010

Return to query results.
Submit another query.