DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tis11 and AT3G19360

DIOPT Version :9

Sequence 1:NP_001259490.1 Gene:Tis11 / 32222 FlyBaseID:FBgn0011837 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_001327691.1 Gene:AT3G19360 / 821470 AraportID:AT3G19360 Length:386 Species:Arabidopsis thaliana


Alignment Length:414 Identity:90/414 - (21%)
Similarity:139/414 - (33%) Gaps:137/414 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 IQQQQQQHQQQQQQQPAVASLVTITENLGNMNLHRKLERTQSEPLPPQQ-----------PMNTS 134
            :.:.|.|.|..||.|||:.....:.:||.|        ...|.|.|...           |:|..
plant    43 LSESQSQSQPSQQLQPALKRPRLVDDNLFN--------PASSFPQPSSSNPWMVPSLNPPPVNKG 99

  Fly   135 R----YKTELCRPFEEAGECKYGEKCQFAHGSHELR--------------------------NVH 169
            .    |||.:|..| .||.|:.||.|.||||..:||                          ...
plant   100 TANIFYKTRMCAKF-RAGTCRNGELCNFAHGIEDLRQPPSNWQEIVGPPPAGQDRERERERERER 163

  Fly   170 RHPK----------------YKTEYCRTFHSVGFCPYGPRCHFVHNADEARAQQAAQAAKSSTQS 218
            ..|.                .:.:.||.|.....||||.||:|:|.......:.:.:..:||..|
plant   164 ERPSLAPVVNNNWEDDQKIILRMKLCRKFCFGEECPYGDRCNFIHEDLSKFREDSGKLRESSVIS 228

  Fly   219 QSQSQQSSSQNFSPKSNQSSNQSSNSSSSSSSSGGGGGGGNSIN-NNNGSQFYLPLSPPLSMSTG 282
            ...:              :::|.|:::|            |.|. |..||   :|:  |..|:.|
plant   229 VGAT--------------AADQPSDTAS------------NLIEVNRQGS---IPV--PAPMNNG 262

  Fly   283 SDRESPTGSLSLSPTNSLT-SFPFHDALQHGYLASNGAKSNSSASSTSSASGMGLGMSMGIGQGM 346
            ...::......|.....:| ..||.|..   :.|...|:.::|                      
plant   263 GVVKTVYWKTRLCMKFDITGQCPFGDKC---HFAHGQAELHNS---------------------- 302

  Fly   347 IIGQGLGMGHHGPATPPESPNVPISPVHTPPPYDVVVSGSGAGNNSVG--SKQLLQKSVSTPMQQ 409
             :|:..|...:..|:..:...||.:......|...|.:.| :|.|..|  .|.||:.|.|..:.:
plant   303 -VGRVEGEAMNAVASVNKQAVVPANEAFAMKPITQVTADS-SGLNEEGRRKKCLLKWSDSKKINR 365

  Fly   410 ------EDTPRLPVFNRLSSGVEA 427
                  :|   |||..:.:..||:
plant   366 IYGDWIDD---LPVGQKSTKPVES 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tis11NP_001259490.1 zf-CCCH 136..161 CDD:279036 13/24 (54%)
zf-CCCH 174..198 CDD:279036 10/23 (43%)
AT3G19360NP_001327691.1 zf-CCCH 105..129 CDD:279036 13/24 (54%)
ZnF_C3H1 185..210 CDD:214632 11/24 (46%)
zf-CCCH 270..296 CDD:279036 6/28 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5063
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101179
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.670

Return to query results.
Submit another query.