DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tis11 and ZFN1

DIOPT Version :9

Sequence 1:NP_001259490.1 Gene:Tis11 / 32222 FlyBaseID:FBgn0011837 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_566183.1 Gene:ZFN1 / 821230 AraportID:AT3G02830 Length:397 Species:Arabidopsis thaliana


Alignment Length:311 Identity:64/311 - (20%)
Similarity:91/311 - (29%) Gaps:125/311 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 TSRYKTEL--------CRPFEEAGECKYGEKCQFAHGSHEL-------RNVHRHPKYKTEY-CRT 181
            |:|.:.|.        |..:.:.|.||:|..|:|.|..::.       .|:..:|....|. |..
plant    75 TARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAY 139

  Fly   182 FHSVGFCPYGPRCHFVHNADEARAQQAAQAAKSSTQSQSQSQQSSSQNF--SPKSNQSSNQSS-- 242
            |...|.|.:|..|.|.|    .:.|.......:|.|   ||...|..:|  ||:....|:.:|  
plant   140 FLRTGHCKFGGTCKFNH----PQPQPTNMMVPTSGQ---QSYPWSRASFIASPRWQDPSSYASLI 197

  Fly   243 -----------NSSSSSSSSGGGGGGGNSINNNNGSQFYLPLSPPLSMSTGSDRESPTGSLSLSP 296
                       |..|....|....|.||..|..|                               
plant   198 MPQGVVPVQGWNPYSGQLGSVSPSGTGNDQNYRN------------------------------- 231

  Fly   297 TNSLTSFPFHDALQHGYLASNGAKSNSSASSTSSASGMGLGMSMGIGQGMIIGQGLGMGHHGPAT 361
                        ||......:|::|..|.|..:..|.:.||                 |::  |.
plant   232 ------------LQQNETIESGSQSQGSFSGYNPGSSVPLG-----------------GYY--AL 265

  Fly   362 P-----PESPNVP---------------ISPVHTP-----PPYDVVVSGSG 387
            |     ||.|..|               :...|.|     ||.|.::|..|
plant   266 PRENVFPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIG 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tis11NP_001259490.1 zf-CCCH 136..161 CDD:279036 8/32 (25%)
zf-CCCH 174..198 CDD:279036 8/24 (33%)
ZFN1NP_566183.1 zf-CCCH 41..67 CDD:395517
zf-CCCH 87..112 CDD:395517 8/24 (33%)
zf-CCCH 134..158 CDD:395517 9/27 (33%)
zf-CCCH 275..301 CDD:395517 3/25 (12%)
zf-CCCH 321..347 CDD:395517
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5063
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.