DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tis11 and HUA1

DIOPT Version :9

Sequence 1:NP_001259490.1 Gene:Tis11 / 32222 FlyBaseID:FBgn0011837 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_187874.2 Gene:HUA1 / 820448 AraportID:AT3G12680 Length:524 Species:Arabidopsis thaliana


Alignment Length:157 Identity:37/157 - (23%)
Similarity:59/157 - (37%) Gaps:36/157 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 QPAVASLVTITENLGNMNL-----HRKLERTQSEP-------LPPQQPMNTSRYKTELCRPFEEA 147
            |.|..:...::.|..|:||     .....:|.::|       ..||:|..:.      |..:.:.
plant   374 QAAGVNYSLVSSNTANLNLGLVTPATSFYQTLTQPTLGVISATYPQRPGQSE------CDYYMKT 432

  Fly   148 GECKYGEKCQFAHGSHEL----RNVHRHPKYKTEY-----------CRTFHSVGFCPYGPRCHFV 197
            ||||:||:|:|.|.:..|    :...:.|..|...           |..:...|.|.||..|.|.
plant   433 GECKFGERCKFHHPADRLSAMTKQAPQQPNVKLSLAGYPRREGALNCPYYMKTGTCKYGATCKFD 497

  Fly   198 H---NADEARAQQAAQAAKSSTQSQSQ 221
            |   ....|:....|.||.::....:|
plant   498 HPPPGEVMAKTTSEADAAGATNTDTTQ 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tis11NP_001259490.1 zf-CCCH 136..161 CDD:279036 9/24 (38%)
zf-CCCH 174..198 CDD:279036 8/34 (24%)
HUA1NP_187874.2 zf-CCCH 342..367 CDD:395517
zf-CCCH 421..446 CDD:395517 10/30 (33%)
zf-CCCH 478..500 CDD:395517 8/21 (38%)
zf-CCCH 176..200 CDD:395517
zf-CCCH 226..252 CDD:395517
zf-CCCH 274..295 CDD:395517
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5063
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.