DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tis11 and AT3G12130

DIOPT Version :10

Sequence 1:NP_511141.2 Gene:Tis11 / 32222 FlyBaseID:FBgn0011837 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_566412.1 Gene:AT3G12130 / 820388 AraportID:AT3G12130 Length:248 Species:Arabidopsis thaliana


Alignment Length:123 Identity:30/123 - (24%)
Similarity:50/123 - (40%) Gaps:42/123 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 QQHQQQPHRHHGGLTRTISQPAQLIQQQQQQHQQQQQQQPAVASLVTITENLGNMNLHRKLERTQ 121
            |.|::.|:..:..|..|:.|.::                   ||.: :.:.:|.:|...|     
plant   150 QDHERDPNLKNIVLEGTLEQISE-------------------ASAM-VKDLIGRLNSAAK----- 189

  Fly   122 SEPLPP-------------QQPMNTSRYKTELCRPFEEAGECKYGEKCQFAHGSHELR 166
               .||             .:|...|.:||::|..|.: |.|.:|::|.||||..|||
plant   190 ---KPPGGGLGGGGGMGSEGKPHPGSNFKTKICERFSK-GNCTFGDRCHFAHGEAELR 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tis11NP_511141.2 CTH1 <121..>198 CDD:227395 19/59 (32%)
AT3G12130NP_566412.1 ZnF_C3H1 37..61 CDD:214632
KH-I_AtC3H36_like 116..181 CDD:411892 8/50 (16%)
ZnF_C3H1 213..239 CDD:214632 11/26 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.