DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tis11 and AT2G47850

DIOPT Version :9

Sequence 1:NP_001259490.1 Gene:Tis11 / 32222 FlyBaseID:FBgn0011837 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_001078078.1 Gene:AT2G47850 / 819397 AraportID:AT2G47850 Length:468 Species:Arabidopsis thaliana


Alignment Length:200 Identity:46/200 - (23%)
Similarity:70/200 - (35%) Gaps:57/200 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 LERTQSEPLPPQQPMNTSRYKTELCRPFEEAGECKYGEKCQFAHGSHEL---RNVHRHP-----K 173
            :::.|:.|..|.:|.         |:.:.:.|:||:|..|:|.|....:   .|....|     :
plant   280 IQKEQAFPERPGEPE---------CQYYLKTGDCKFGTSCKFHHPRDRVPPRANCVLSPIGLPLR 335

  Fly   174 YKTEYCRTFHSVGFCPYGPRCHFVHNADEAR----------------------AQQAAQAAKSST 216
            ...:.|..:...|||.:|..|.|.|.....|                      ...||..:.|||
plant   336 PGVQRCTFYVQNGFCKFGSTCKFDHPMGTIRYNPSASSLADAPVAPYPVSSLLGALAAAPSSSST 400

  Fly   217 QSQSQSQQSSSQNFSPKSNQSSNQSSNSSSSSSSSGGGGGGGNSINNNN---GSQFYLPLSPPLS 278
            :..:...:.:.....|.|..:||.|:....|.|        |.||..:.   .||..|||     
plant   401 ELIAGGAKDAYMTGVPTSRSTSNISAGLIFSQS--------GGSIPFSELQLSSQSSLPL----- 452

  Fly   279 MSTGS 283
              |||
plant   453 --TGS 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tis11NP_001259490.1 zf-CCCH 136..161 CDD:279036 7/24 (29%)
zf-CCCH 174..198 CDD:279036 7/23 (30%)
AT2G47850NP_001078078.1 zf-CCCH 46..72 CDD:395517
zf-CCCH 91..117 CDD:395517
zf-CCCH 141..163 CDD:395517
zf-CCCH 290..316 CDD:395517 10/34 (29%)
zf-CCCH 336..362 CDD:395517 8/25 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5063
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.