DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tis11 and CZF1

DIOPT Version :9

Sequence 1:NP_001259490.1 Gene:Tis11 / 32222 FlyBaseID:FBgn0011837 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_001031517.1 Gene:CZF1 / 818605 AraportID:AT2G40140 Length:597 Species:Arabidopsis thaliana


Alignment Length:412 Identity:98/412 - (23%)
Similarity:141/412 - (34%) Gaps:136/412 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 NEVRKEIRMLLA--HGANLDQQHQQQPHRHHGGLTRTISQPAQLIQQQQQQHQQQQQQQPAVASL 101
            |:.||.:.:||.  ||:                          ::::::::.:....:.||.|||
plant   164 NQSRKAVEVLLTGIHGS--------------------------VMEEEEEELKSVVTKYPADASL 202

  Fly   102 VTITENLGNMNLHRKL-------ERTQSE---PLPPQQPMNTSR--------YKTELCRPFEEAG 148
            ..|.|.:...:..|..       .|..|.   ..|...|...:|        |....|..|.: |
plant   203 PDINEGVYGTDDFRMFSFKVKPCSRAYSHDWTECPFVHPGENARRRDPRKYPYTCVPCPEFRK-G 266

  Fly   149 ECKYGEKCQFAHGSHELRNVHRHP-KYKTEYCRTFHSVGFCPYGPRCHFVHNADEARAQQAAQAA 212
            .|..|:.|::|||..|   ...|| :|:|..|:  ...| |.... |.|.|..||.|...|    
plant   267 SCPKGDSCEYAHGVFE---SWLHPAQYRTRLCK--DETG-CARRV-CFFAHRRDELRPVNA---- 320

  Fly   213 KSSTQSQSQSQQSSSQNFSPKSNQSSNQSSNSSSSSSSSGGGGGGGNSINNNNGSQFYLPLSPPL 277
              ||.|...|.:||:|  ||:.:..|..:..||..:|....|                :||||  
plant   321 --STGSAMVSPRSSNQ--SPEMSVMSPLTLGSSPMNSPMANG----------------VPLSP-- 363

  Fly   278 SMSTGSDRESPTGSLSLSPTNSLTSFPFHDALQHGYLASNGAKSNSSASSTSSASGMGLGMSMGI 342
                      ..|.|..:..||||..|         |..||    |...||.||..|.:.|.:..
plant   364 ----------RNGGLWQNRVNSLTPPP---------LQLNG----SRLKSTLSARDMDMEMELRF 405

  Fly   343 GQGMIIGQGLGMGHHGPATPP-----------------ESP-------NVPISPVHTPPPYDVVV 383
                   :||.....|...|.                 :||       :.|.|||..|||:....
plant   406 -------RGLDNRRLGDLKPSNLEETFGSYDSASVMQLQSPSRHSQMNHYPSSPVRQPPPHGFES 463

  Fly   384 SGS-GAGNNSVGSKQLLQKSVS 404
            |.: .|...:..|....::|:|
plant   464 SAAMAAAVMNARSSAFAKRSLS 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tis11NP_001259490.1 zf-CCCH 136..161 CDD:279036 8/24 (33%)
zf-CCCH 174..198 CDD:279036 7/23 (30%)
CZF1NP_001031517.1 Ank_2 <76..145 CDD:403870
ANK repeat 76..109 CDD:293786
ANK repeat 111..145 CDD:293786
ZnF_C3H1 258..279 CDD:214632 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I2649
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
22.010

Return to query results.
Submit another query.