DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tis11 and AT2G35430

DIOPT Version :9

Sequence 1:NP_001259490.1 Gene:Tis11 / 32222 FlyBaseID:FBgn0011837 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_181086.2 Gene:AT2G35430 / 818109 AraportID:AT2G35430 Length:252 Species:Arabidopsis thaliana


Alignment Length:160 Identity:42/160 - (26%)
Similarity:61/160 - (38%) Gaps:43/160 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 SRYKTELCRPFEEAGECKY-GEKCQFAHGSHELR------------------------------- 166
            |.:||:||..| .||.|.| ...|.|||.:.|||                               
plant    70 SFFKTKLCFKF-RAGTCPYSASSCHFAHSAEELRLPPPPPPNWQETVTEASRNRESFAVSLGPRG 133

  Fly   167 NVH---RHPKYKTEYCRTFHSVGFCPYGPRCHFVHNADEAR------AQQAAQAAKSSTQSQSQS 222
            ||.   :.|.:||..|..:.:.|:||:|..|||.|...|..      .:...:...|:|....|.
plant   134 NVAQTLKSPNWKTRICNKWQTTGYCPFGSHCHFAHGPSELHTFGGGLVEGECKIGTSATLDTKQR 198

  Fly   223 QQSSSQNFSPKSNQSSNQSSNSSSSSSSSG 252
            .|..:.. |..|...|:|.::|:.:...:|
plant   199 GQVDTVT-SLVSPGVSSQRTSSAVTQKPNG 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tis11NP_001259490.1 zf-CCCH 136..161 CDD:279036 12/25 (48%)
zf-CCCH 174..198 CDD:279036 10/23 (43%)
AT2G35430NP_181086.2 CTH1 <66..173 CDD:227395 31/103 (30%)
zf-CCCH 144..169 CDD:366217 10/24 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5063
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.