DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tis11 and Zfp36

DIOPT Version :9

Sequence 1:NP_001259490.1 Gene:Tis11 / 32222 FlyBaseID:FBgn0011837 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_579824.2 Gene:Zfp36 / 79426 RGDID:620722 Length:326 Species:Rattus norvegicus


Alignment Length:320 Identity:101/320 - (31%)
Similarity:119/320 - (37%) Gaps:96/320 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 ERTQSEPLPPQQPMNTSRYKTELCRPFEEAGECKYGEKCQFAHGSHELRNVHRHPKYKTEYCRTF 182
            |.:.|...|...|..:|||||||||.:.|:|.|:||.|||||||..|||..:||||||||.|..|
  Rat    85 ELSPSPTSPTATPTTSSRYKTELCRTYSESGRCRYGAKCQFAHGPGELRQANRHPKYKTELCHKF 149

  Fly   183 HSVGFCPYGPRCHFVHNADEARAQQAAQAAKSSTQSQSQSQQSSSQNFSPKSNQSSNQSSNSSSS 247
            :..|.||||.||||:||..|..|.......  ..||.|.|...|.:..||.....|..|.:|.|.
  Rat   150 YLQGRCPYGSRCHFIHNPTEDLALPGQPHV--LRQSISFSGLPSGRRTSPPPPGFSGPSLSSCSF 212

  Fly   248 SSSSGGGGGGGNSINNNNGSQFYLPLSP---------------PLSMSTGSDRESPTGSLSLSPT 297
            |.||.....|.            |||||               |......|.|.|.|.|....|.
  Rat   213 SPSSSPPPPGD------------LPLSPSAFSAAPGTPVSRRDPTPACCPSCRRSTTPSTIWGPL 265

  Fly   298 NSLTSFPFHDALQHGYLASNGAKSNSSASSTSSASGMGLGMSMGIGQGMIIGQGLGMGHHGPATP 362
            ..|...|...:|        |:..:..|||         |.|:|.....:...|:    .||..|
  Rat   266 GGLARSPSAHSL--------GSDPDDYASS---------GSSLGGSDSPVFEAGV----FGPPQP 309

  Fly   363 PESPNVPISPVHTPPPYDVVVSGSGAGNNSVGSKQLLQKSVSTPMQQEDTPRLPVFNRLS 422
            |..|.                                              |||:|||:|
  Rat   310 PAPPR----------------------------------------------RLPIFNRIS 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tis11NP_001259490.1 zf-CCCH 136..161 CDD:279036 17/24 (71%)
zf-CCCH 174..198 CDD:279036 15/23 (65%)
Zfp36NP_579824.2 zf-CCCH 103..129 CDD:279036 18/25 (72%)
zf-CCCH 141..167 CDD:279036 16/25 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351027
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 128 1.000 Inparanoid score I4572
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000616
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12547
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.