DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tis11 and zfp36l2.2

DIOPT Version :9

Sequence 1:NP_001259490.1 Gene:Tis11 / 32222 FlyBaseID:FBgn0011837 Length:436 Species:Drosophila melanogaster
Sequence 2:XP_012816715.1 Gene:zfp36l2.2 / 733887 XenbaseID:XB-GENE-5885707 Length:289 Species:Xenopus tropicalis


Alignment Length:218 Identity:70/218 - (32%)
Similarity:96/218 - (44%) Gaps:43/218 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 PL-PPQQP----------------MNTSRYKTELCRPFEEAGECKYGEKCQFAHGSHELRNVHRH 171
            || ||..|                :::.|||||||..:.|:|.|.|..:||||||..|||...:|
 Frog    27 PLSPPSDPEIPLLPSFSAPPKHLSLSSLRYKTELCTRYAESGFCAYRNRCQFAHGLSELRPPVQH 91

  Fly   172 PKYKTEYCRTFHSVGFCPYGPRCHFVHNADEARAQQAAQAA------KSSTQSQSQSQQSSSQNF 230
            ||||||.||:||.:|.|.||.||.|:|:..|.|....:..|      :.:...:.|.:...|...
 Frog    92 PKYKTELCRSFHVLGTCNYGLRCLFIHSPQERREPPVSPDAPGLPTRRYAGPYREQCRLWRSPGG 156

  Fly   231 SPKSNQSSNQSSNSSSSSSSSGGGGGGGNSINNNNGSQFYLPLSPPLSM-------STGS----- 283
            .|...:...|.......:.......|     :...|::.:...||||..       |:||     
 Frog   157 CPYGARCHFQHPKGFREACRHFAAHG-----DCPYGARCHFSHSPPLDRWGSGTKNSSGSLSPSD 216

  Fly   284 -DRESPTGS--LSLSPTNSLTSF 303
             |.:|..|:  ||.||.|:..||
 Frog   217 PDPDSDPGTPVLSESPANNAFSF 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tis11NP_001259490.1 zf-CCCH 136..161 CDD:279036 14/24 (58%)
zf-CCCH 174..198 CDD:279036 15/23 (65%)
zfp36l2.2XP_012816715.1 CTH1 <27..169 CDD:227395 51/141 (36%)
zf-CCCH 171..195 CDD:366217 2/28 (7%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12547
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X9434
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.