DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tis11 and zgc:162730

DIOPT Version :9

Sequence 1:NP_001259490.1 Gene:Tis11 / 32222 FlyBaseID:FBgn0011837 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_001082873.2 Gene:zgc:162730 / 564559 ZFINID:ZDB-GENE-030131-6366 Length:314 Species:Danio rerio


Alignment Length:237 Identity:86/237 - (36%)
Similarity:116/237 - (48%) Gaps:49/237 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 NMNLHRKLERTQSEPLPPQ---QPMNT---SRYKTELCRPFEEAGECKYGEKCQFAHGSHELRNV 168
            :|:|:....|.:...:||.   .|:.|   :||||||||.|:|.|.||||.|||||||.:|||.:
Zfish    59 SMSLNDSFSRMKPHDVPPPPGFPPLATLPSNRYKTELCRSFQEHGSCKYGAKCQFAHGENELRGL 123

  Fly   169 HRHPKYKTEYCRTFHSVGFCPYGPRCHFVHNADEARAQQAAQAAKSS------TQSQSQSQQSSS 227
            :|||||||:.||||:..|:||||.||||:|....:.::|..:..:.|      |:|.|......|
Zfish   124 YRHPKYKTQACRTFYQFGYCPYGSRCHFIHEEKSSLSEQNPRQLRQSVSFAGFTRSSSPPSSYES 188

  Fly   228 QNFSPKSNQS-----------SNQSSNSSSSSSSSGGG----------------GGGGNSINNNN 265
            .:|:...:.|           |:.|.:..|.|..|.|.                .|.||:...:.
Zfish   189 LSFTRAPSVSPPPEEILSPVFSDSSRDMFSFSRHSSGDIHNSALFAPETRSRCVCGHGNNFPVSG 253

  Fly   266 GSQFY------LPLSPPLSMSTGSDRE--SPTGSL--SLSPT 297
            |..:.      .||....|..:.||||  |.|||.  |.|||
Zfish   254 GGLYIKVELKKAPLQRFSSEDSLSDRESYSSTGSSSGSESPT 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tis11NP_001259490.1 zf-CCCH 136..161 CDD:279036 19/24 (79%)
zf-CCCH 174..198 CDD:279036 16/23 (70%)
zgc:162730NP_001082873.2 zf-CCCH 91..117 CDD:279036 20/25 (80%)
zf-CCCH 129..153 CDD:279036 16/23 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000616
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12547
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.