DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tis11 and Zfp36l3

DIOPT Version :9

Sequence 1:NP_001259490.1 Gene:Tis11 / 32222 FlyBaseID:FBgn0011837 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_001305047.1 Gene:Zfp36l3 / 317308 RGDID:1559581 Length:722 Species:Rattus norvegicus


Alignment Length:339 Identity:116/339 - (34%)
Similarity:150/339 - (44%) Gaps:74/339 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 QQPAVASL-VTITENLGNMNLHRKLERTQSEPLPPQQPMNTS-------RYKTELCRPFEEAGEC 150
            |:|:.||. :.:....|..:|.:|         |.||.|::|       ||||||||||||.|.|
  Rat    81 QEPSGASAELRVHPGNGEHSLQQK---------PKQQKMSSSSSQATSERYKTELCRPFEENGTC 136

  Fly   151 KYGEKCQFAHGSHELRNVHRHPKYKTEYCRTFHSVGFCPYGPRCHFVHNADEARAQQAAQAAKSS 215
            :||.|||||||.||||.:.||||||||.||||||:|:||||.||||:||..|.......      
  Rat   137 RYGNKCQFAHGYHELRTLSRHPKYKTEPCRTFHSIGYCPYGSRCHFIHNQPEQLPMLPG------ 195

  Fly   216 TQSQSQSQQSSSQNFSPKSNQSSNQSSNSSSSSSSSGGGGGGGNS--------INN---NNGSQF 269
                |.|::.||.|...:.:...|.........|.|..|...|||        :|.   |:|.  
  Rat   196 ----SVSEEPSSFNGLDEHHLGVNNGERQPRLQSDSPSGFLSGNSQALQAPLQLNQQAMNSGR-- 254

  Fly   270 YLPLSPP----LSMSTGSDRESPTGSLSLSPTNSLTSFPFHDALQHGYLA--SNGAKSNSSASST 328
            :||.|.|    |.|.......|..|:   .|.:..|:   ||......|.  |..|..|.:.:.|
  Rat   255 FLPASYPGAANLPMIASPTMVSEPGN---DPRSDFTN---HDIAFRQELGGFSPVAFQNPTTTPT 313

  Fly   329 ---SSASGMGLGMSMGIGQGM--------IIGQGLGMGH------HGPATPPES----PNVPISP 372
               ::...|||..|......:        |.|| .|:|.      .||||.|.:    |...::|
  Rat   314 DCYNNQQQMGLPASAQFQMPLAGPSPSTTIFGQ-TGVGRTAAAIAPGPATAPGAAALVPGAAMAP 377

  Fly   373 VHTPPPYDVVVSGS 386
            .....|...|.:|:
  Rat   378 GTALAPGAAVATGT 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tis11NP_001259490.1 zf-CCCH 136..161 CDD:279036 20/24 (83%)
zf-CCCH 174..198 CDD:279036 19/23 (83%)
Zfp36l3NP_001305047.1 zf-CCCH 122..147 CDD:279036 20/24 (83%)
zf-CCCH 160..186 CDD:279036 20/25 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5063
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101179
Panther 1 1.100 - - O PTHR12547
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.860

Return to query results.
Submit another query.