DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tis11 and cth1

DIOPT Version :9

Sequence 1:NP_001259490.1 Gene:Tis11 / 32222 FlyBaseID:FBgn0011837 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_571014.1 Gene:cth1 / 30114 ZFINID:ZDB-GENE-990806-20 Length:319 Species:Danio rerio


Alignment Length:246 Identity:76/246 - (30%)
Similarity:106/246 - (43%) Gaps:59/246 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 GNMNLHRKLERTQSEPLPPQQP-MNTSRYKTELCRPFEEAGECKYGEKCQFAHGSHELRNVHRHP 172
            |.::|...|......|.||..| :.::|||||||..:.|.|.|||.|:||||||.|:|....|||
Zfish    32 GGLSLAEALLPLVESPSPPMTPWLCSTRYKTELCSRYAETGTCKYAERCQFAHGLHDLHVPSRHP 96

  Fly   173 KYKTEYCRTFHSVGFCPYGPRCHFVHNADEARA-----------------------------QQA 208
            |||||.|||:|:.|:|.||.||.||||..|.|.                             .:.
Zfish    97 KYKTELCRTYHTAGYCVYGTRCLFVHNLKEQRPIRPRRRNVPCRTFRAFGVCPFGNRCHFLHVEG 161

  Fly   209 AQAAKSSTQSQSQSQQSSSQNFSPKSNQSSNQSSNSSSSSSSSGG----------GGGGGNSINN 263
            ...:..:.:.|:....|.||.:.|:         .:...:.|:.|          ..|..|:|..
Zfish   162 GSESDGAEEEQTWQPPSQSQEWKPR---------GALCRTFSAFGFCLYGTRCRFQHGLPNTIKG 217

  Fly   264 NNGSQFYLPLSPPLSMSTG------SDRESPTGSLSLSPTNSLTSFPFHDA 308
            :|.:.    .|.|..|:.|      ||..:.....|.|||::|.|..:.|:
Zfish   218 HNANH----TSWPQQMTNGGSISPISDTCTSPSPPSSSPTSALPSPVYPDS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tis11NP_001259490.1 zf-CCCH 136..161 CDD:279036 16/24 (67%)
zf-CCCH 174..198 CDD:279036 15/23 (65%)
cth1NP_571014.1 zf-CCCH 60..85 CDD:279036 16/24 (67%)
zf-CCCH 98..122 CDD:279036 15/23 (65%)
zf-CCCH 137..160 CDD:279036 0/22 (0%)
zf-CCCH 188..210 CDD:279036 2/21 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592756
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5063
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000616
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12547
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X9434
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.