DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tis11 and Y110A2AL.10

DIOPT Version :9

Sequence 1:NP_001259490.1 Gene:Tis11 / 32222 FlyBaseID:FBgn0011837 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_494389.2 Gene:Y110A2AL.10 / 190939 WormBaseID:WBGene00022446 Length:111 Species:Caenorhabditis elegans


Alignment Length:90 Identity:19/90 - (21%)
Similarity:33/90 - (36%) Gaps:13/90 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 NMNLHRKLERTQSEPLPPQQPMNTSRYKTELCRPFEEAGECKYGEKCQFAHGSHELRNVHRHPKY 174
            |:|:.|..|......:.||..::   :..::....|:.|..    :.:...|:|...|:   |..
 Worm    27 NLNVLRATEYFDLHGMTPQGALD---FVLQIVSLMEKGGSI----QLETGRGNHSPGNI---PAI 81

  Fly   175 KTEYCRTFHSVGFCPYGPRCHFVHN 199
            |....:.|   |.|.|...|....|
 Worm    82 KLRLLQEF---GNCSYISICEHPQN 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tis11NP_001259490.1 zf-CCCH 136..161 CDD:279036 2/24 (8%)
zf-CCCH 174..198 CDD:279036 6/23 (26%)
Y110A2AL.10NP_494389.2 Smr 36..108 CDD:383054 15/81 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165273
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.