DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tis11 and Y110A2AL.1

DIOPT Version :9

Sequence 1:NP_001259490.1 Gene:Tis11 / 32222 FlyBaseID:FBgn0011837 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_494390.1 Gene:Y110A2AL.1 / 190934 WormBaseID:WBGene00022438 Length:142 Species:Caenorhabditis elegans


Alignment Length:51 Identity:14/51 - (27%)
Similarity:21/51 - (41%) Gaps:12/51 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 SGAGNNSVGSKQLLQKSVSTPMQQEDTPRLPVFNRLSSGVEAYQQQSNLGL 436
            :|.||:|..:...:|..:           |..|..| ||.:.....||||:
 Worm    98 TGRGNHSKDNIPAIQNRL-----------LQDFGNL-SGFQIAIDPSNLGV 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tis11NP_001259490.1 zf-CCCH 136..161 CDD:279036
zf-CCCH 174..198 CDD:279036
Y110A2AL.1NP_494390.1 Smr 66..141 CDD:383054 14/51 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165274
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.