powered by:
Protein Alignment Tis11 and Y110A2AL.1
DIOPT Version :9
Sequence 1: | NP_001259490.1 |
Gene: | Tis11 / 32222 |
FlyBaseID: | FBgn0011837 |
Length: | 436 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_494390.1 |
Gene: | Y110A2AL.1 / 190934 |
WormBaseID: | WBGene00022438 |
Length: | 142 |
Species: | Caenorhabditis elegans |
Alignment Length: | 51 |
Identity: | 14/51 - (27%) |
Similarity: | 21/51 - (41%) |
Gaps: | 12/51 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 386 SGAGNNSVGSKQLLQKSVSTPMQQEDTPRLPVFNRLSSGVEAYQQQSNLGL 436
:|.||:|..:...:|..: |..|..| ||.:.....||||:
Worm 98 TGRGNHSKDNIPAIQNRL-----------LQDFGNL-SGFQIAIDPSNLGV 136
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Tis11 | NP_001259490.1 |
zf-CCCH |
136..161 |
CDD:279036 |
|
zf-CCCH |
174..198 |
CDD:279036 |
|
Y110A2AL.1 | NP_494390.1 |
Smr |
66..141 |
CDD:383054 |
14/51 (27%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160165274 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.