DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tis11 and F38C2.7

DIOPT Version :9

Sequence 1:NP_001259490.1 Gene:Tis11 / 32222 FlyBaseID:FBgn0011837 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_502930.1 Gene:F38C2.7 / 185463 WormBaseID:WBGene00009539 Length:203 Species:Caenorhabditis elegans


Alignment Length:168 Identity:46/168 - (27%)
Similarity:69/168 - (41%) Gaps:32/168 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SQPAQLIQQQQQQHQQQQQQQPAVASLVTITENLGNMNLHRKLERTQSEPLPPQQPMNTSRYKTE 139
            :|.:..:.|.:.:.:....|..|.....||.:     .||::::..:.:         ...:||.
 Worm    42 AQFSLFVNQNETEQKLFSNQSLANRDPCTIPD-----ELHQEMKSLKKK---------EEAFKTS 92

  Fly   140 LCRPFEEAGECKYGEKCQFAHGSHELR---NVHRHPKYKTEYCRTFHSVGFCPYGPRCHFVHNAD 201
            ||.......:|.|||||:|||..||||   ....|..|||..|..|.:.|.|.||.||.|:|.  
 Worm    93 LCGFHRRGQKCAYGEKCKFAHSVHELRFPQTKRNHRNYKTVLCNNFSTTGHCKYGIRCQFIHR-- 155

  Fly   202 EARAQQAAQAAKSSTQSQSQSQQSSSQNFSPKSNQSSN 239
                         |..|.|.:|.:..:|.:...|..|:
 Worm   156 -------------SMNSTSSNQSNKMENITIDLNVQSD 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tis11NP_001259490.1 zf-CCCH 136..161 CDD:279036 12/24 (50%)
zf-CCCH 174..198 CDD:279036 12/23 (52%)
F38C2.7NP_502930.1 zf-CCCH 89..115 CDD:279036 13/25 (52%)
zf-CCCH 130..154 CDD:279036 12/23 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165267
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5063
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12547
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.800

Return to query results.
Submit another query.