DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tis11 and F02E11.4

DIOPT Version :10

Sequence 1:NP_511141.2 Gene:Tis11 / 32222 FlyBaseID:FBgn0011837 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_494494.1 Gene:F02E11.4 / 184098 WormBaseID:WBGene00017182 Length:138 Species:Caenorhabditis elegans


Alignment Length:38 Identity:12/38 - (31%)
Similarity:18/38 - (47%) Gaps:4/38 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 YGE-KCQFAHGSHELRNVHRHPKYKTEYCRTFHSVGFC 188
            ||: |.:...|:|...|:   |..|.:..|||:....|
 Worm    87 YGKIKLETGRGNHSKDNI---PVIKNKLLRTFNCRSRC 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tis11NP_511141.2 CTH1 <121..>198 CDD:227395 12/38 (32%)
F02E11.4NP_494494.1 SMR 60..137 CDD:214676 12/38 (32%)

Return to query results.
Submit another query.