DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tis11 and pos-1

DIOPT Version :9

Sequence 1:NP_001259490.1 Gene:Tis11 / 32222 FlyBaseID:FBgn0011837 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_001379937.1 Gene:pos-1 / 179224 WormBaseID:WBGene00004078 Length:264 Species:Caenorhabditis elegans


Alignment Length:233 Identity:66/233 - (28%)
Similarity:102/233 - (43%) Gaps:37/233 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NDHLGDFDCNEVRKEIRMLLAHGANLDQQHQQQPHRHHGGLTRTISQPAQLIQQQQQQHQQQQQQ 94
            ||.|........:|||         ||.         |...||::|..:...:...|::...|..
 Worm     4 NDFLSGEAIMVFKKEI---------LDS---------HSDFTRSLSHQSASPEAYDQENVFSQDF 50

  Fly    95 QPAV---------ASLVTITENLGNMNLHRKLERTQSEPLPPQQPMNTSRYKTELCRPFEEAGEC 150
            ||.:         ||..|..::|.|.:.....:..:.|.:  :|......:||.||..::.:..|
 Worm    51 QPFMKQDKETQNSASQPTSEQSLANRDPCTVPDDLREEMM--RQRRKEDAFKTALCDAYKRSQAC 113

  Fly   151 KYGEKCQFAHGSHELR-----NVHRHPKYKTEYCRTFHSVGFCPYGPRCHFVHNADEARAQQAAQ 210
            .||::|:||||.||||     ....||||||..|..|...|.|.||.||.|:|...:..|.:.|.
 Worm   114 SYGDQCRFAHGVHELRLPMNPRGRNHPKYKTVLCDKFSMTGNCKYGTRCQFIHKIVDGNAAKLAS 178

  Fly   211 AAKSSTQSQSQSQQSSSQN---FSPKSNQSSNQSSNSS 245
            .|.::|.|:|.::.:::.|   |.|:.:...:...|.|
 Worm   179 GAHANTSSKSPARNAAAHNHSLFVPQGSTDRSMDLNQS 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tis11NP_001259490.1 zf-CCCH 136..161 CDD:279036 10/24 (42%)
zf-CCCH 174..198 CDD:279036 12/23 (52%)
pos-1NP_001379937.1 CTH1 <47..222 CDD:227395 53/172 (31%)
zf-CCCH 99..125 CDD:395517 11/25 (44%)
zf-CCCH 142..166 CDD:395517 12/23 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165264
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5063
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2657
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12547
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.750

Return to query results.
Submit another query.