DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tis11 and Y116A8C.19

DIOPT Version :9

Sequence 1:NP_001259490.1 Gene:Tis11 / 32222 FlyBaseID:FBgn0011837 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_503019.1 Gene:Y116A8C.19 / 178477 WormBaseID:WBGene00013796 Length:196 Species:Caenorhabditis elegans


Alignment Length:153 Identity:44/153 - (28%)
Similarity:75/153 - (49%) Gaps:30/153 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 QQHQQQQQQQPAVASLVTITENLGNMNLHRKLERTQSEPLPPQQPMNTSRYKTELCRPFEEAGE- 149
            :||:.::...      .||::     :||.:::|.:.:         ...:||.|| .|:..|: 
 Worm    54 KQHKSRKYDS------CTISD-----DLHDEMKRLKKK---------EEAFKTALC-GFQRRGQK 97

  Fly   150 CKYGEKCQFAHGSHELR-----NVHRHPKYKTEYCRTFHSVGFCPYGPRCHFVHNA-DEARAQQA 208
            |.|||:|:|||..||||     ..||:  |||..|..|.:.|:|.||.||.|:|.| ......::
 Worm    98 CIYGEQCKFAHSVHELRFTQAKKTHRN--YKTVLCDKFSTTGYCKYGARCQFIHRALGSTSTTES 160

  Fly   209 AQAAKSSTQSQSQSQQSSSQNFS 231
            |:.|......:|...::.:.:::
 Worm   161 AEMADFKLNVESDLSRAFALDYT 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tis11NP_001259490.1 zf-CCCH 136..161 CDD:279036 13/25 (52%)
zf-CCCH 174..198 CDD:279036 12/23 (52%)
Y116A8C.19NP_503019.1 zf-CCCH 84..110 CDD:279036 14/26 (54%)
zf-CCCH 125..149 CDD:279036 12/23 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165268
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5063
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12547
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.800

Return to query results.
Submit another query.